Cps1 (NM_001080809) Mouse Tagged ORF Clone

CAT#: MR222149

Cps1 (Myc-DDK-tagged) - Mouse carbamoyl-phosphate synthetase 1 (Cps1), nuclear gene encoding mitochondrial protein

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 1,906.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Cps1 (NM_001080809) Mouse Tagged ORF Clone
Symbol Cps1
Synonyms 4732433M03Rik; CPS; D1Ucla3
Vector pCMV6-Entry
Sequence Data
>MR222149 representing NM_001080809
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGAGGATTTTGACAGCTTGCAAAGTGGTGAAGACCCTGAAGAGTGGCTTTGGTTTTGCCAATGTGA
CTACGAAGCGACAGTGGGACTTCTCCAGACCTGGCATCAGGCTCCTTTCTGTGAAGGCAAAGACAGCACA
CATTGTTCTGGAAGATGGAACTAAGATGAAAGGCTACTCCTTTGGCCATCCCTCCTCTGTTGCTGGTGAA
GTGGTTTTTAATACTGGCTTAGGAGGGTACCCGGAAGCACTTACTGATCCCGCCTACAAGGGGCAGATCC
TCACCATGGCCAACCCTATCATTGGGAACGGTGGGGCTCCCGACACCACTGCCCGAGACGAACTGGGACT
GAATAAGTACATGGAGTCTGATGGGATCAAGGTGGCAGGTCTGCTGGTTCTGAATTACAGTAATGACTAT
AACCACTGGCTGGCTACCAAGAGTCTGGGTCAATGGCTGCAGGAGGAAAAGGTCCCTGCAATTTATGGAG
TGGATACAAGAATGCTGACTAAAATAATTCGGGATAAGGGTACCATGCTTGGGAAGATTGAATTTGAAGG
CCAGTCTGTGGATTTTGTGGATCCCAATAAGCAGAATTTGATTGCTGAGGTTTCAACCAAGGATGTCAAG
GTGTTTGGCAAAGGAAACCCCACGAAAGTGGTAGCTGTGGACTGTGGGATAAAAAACAATGTCATCCGCC
TGCTAGTTAAGCGAGGAGCTGAAGTGCATTTGGTTCCCTGGAATCACGACTTCACCCAGATGGAGTATGA
TGGACTTTTGATTGCTGGGGGACCTGGGAATCCAGCTCTTGCACAGCCACTAATTCAGAATGTGAAAAAG
ATTTTGGAGAGTGACCGCAAAGAGCCATTGTTTGGAATCAGTACAGGAAACATAATAACAGGATTGGCTG
CTGGTGCCAAATCCTACAAGATGTCCATGGCCAACAGAGGACAGAACCAACCTGTTTTGAATATCACAAA
CAGACAGGCTTTCATAACTGCTCAGAATCATGGCTATGCTCTGGACAACACACTCCCTGCTGGCTGGAAA
CCACTGTTTGTGAATGTCAATGATCAAACAAACGAGGGGATTATGCATGAGAGCAAACCTTTCTTCGCTG
TGCAGTTCCACCCAGAGGTCAGCCCGGGGCCAACAGACACTGAGTACCTATTTGATTCCTTCTTCTCCCT
GATAAAGAAGGGCAAAGGCACCACCATTACCTCAGTTCTGCCCAAGCCAGCGTTGGTGGCATCTCGTGTC
GAGGTTTCCAAGGTCCTCATCCTGGGATCAGGAGGTCTGTCCATTGGTCAGGCAGGTGAATTTGATTACT
CGGGATCTCAAGCTGTGAAAGCCATGAAGGAAGAAAATGTCAAAACAGTCCTGATGAACCCGAACATCGC
ATCCGTGCAGACCAACGAGGTGGGATTGAAGCAGGCAGATGCAGTCTACTTTCTCCCTATTACCCCCCAG
TTTGTCACAGAAGTTATCAAGGCTGAACGGCCTGATGGGCTGATTCTGGGCATGGGTGGCCAGACAGCTC
TGAACTGTGGAGTGGAACTATTCAAGAGGGGTGTGCTCAAGGAATATGGGGTGAAGGTCTTGGGCACATC
AGTTGAGTCCATTATGGCCACAGAAGACAGGCAGCTGTTCTCAGACAAGCTGAATGAGATCAACGAGAAG
ATCGCACCCAGTTTTGCAGTGGAATCAATGGAGGATGCCTTGAAGGCAGCAGACACCATTGGCTACCCTG
TGATGATTCGGTCTGCATATGCTCTGGGTGGCTTAGGCTCTGGCATCTGTCCCAATAAGGAGACCTTAAT
AGACCTTGGCACAAAAGCATTTGCTATGACCAACCAGATCCTGGTGGAGCGGTCAGTGACAGGTTGGAAA
GAAATAGAATATGAAGTTGTCCGAGATGCAGATGATAACTGTGTCACAGTCTGTAACATGGAAAATGTTG
ACGCCATGGGTGTTCACACAGGTGACTCGGTTGTCGTGGCCCCAGCCCAGACACTCTCCAATGCAGAGTT
CCAGATGTTGAGACGCACTTCAGTCAATGTTGTTCGTCACTTGGGCATTGTGGGCGAATGCAACATTCAG
TTTGCTCTTCACCCCACTTCCATGGAATACTGTATCATTGAAGTGAATGCCAGGCTGTCCCGGAGTTCTG
CCCTGGCCTCCAAGGCCACTGGCTACCCACTGGCATTCATTGCAGCAAAGATTGCTCTAGGAATCCCACT
TCCAGAAATCAAGAATGTTGTATCTGGGAAGACCTCAGCCTGCTTCGAACCTAGCCTGGATTACATGGTG
ACCAAGATTCCTCGCTGGGATCTTGACCGTTTCCATGGAACATCCAGCCGAATTGGTAGCTCAATGAAAA
GTGTGGGCGAGGTCATGGCCATTGGTCGCACCTTTGAGGAAAGTTTCCAGAAGGCTCTGAGGATGTGCCA
TCCATCTGTGGATGGGTTCACTCCCCGGCTCCCAATGAATAAGGAATGGCCAGCAAACCTGGATCTGAAG
AAAGAGCTGTCTGAGCCCTCCAGCACCCGCATCTACGCCATTGCTAAGGCCTTGGAGAACAACATGTCCC
TCGACGAAATTGTGAGGCTCACGTCCATCGACAAGTGGTTTCTGTACAAGATGCGTGACATTTTAAACAT
GGATAAGACACTGAAAGGGCTTAACAGTGACTCTGTTACAGAAGAAACTCTGAGAAAGGCCAAGGAGATT
GGGTTCTCAGACAAGCAGATTTCAAAATGTTTGGGACTGACTGAAGCCCAGACAAGAGAGCTGAGGTTAA
AGAAAAACATCCACCCTTGGGTTAAACAGATTGATACATTGGCTGCAGAATACCCATCAGTAACAAACTA
CCTGTATGTTACCTACAACGGCCAGGAGCACGATATCAAATTTGATGAACATGGAATAATGGTTCTGGGC
TGTGGTCCATACCACATTGGCAGCAGTGTGGAATTTGATTGGTGTGCTGTCTCCAGTATCCGTACACTGC
GCCAACTTGGCAAGAAGACAGTGGTGGTGAATTGTAACCCAGAGACTGTGAGCACTGATTTTGATGAGTG
TGACAAACTCTACTTTGAAGAGCTGTCTTTGGAGAGAATCCTAGACATCTACCACCAGGAGGCATGTAAT
GGCTGCATCATATCAGTTGGCGGCCAGATTCCAAACAACTTGGCGGTCCCGCTGTACAAGAATGGTGTCA
AGATCATGGGTACAAGCCCTCTGCAGATCGACAGGGCTGAGGATCGCTCCATCTTCTCAGCTGTCTTAGA
TGAGCTAAAGGTGGCCCAGGCTCCATGGAAAGCTGTGAACACTTTGAATGAAGCACTGGAATTTGCAAAC
TCTGTGGGCTACCCCTGCTTACTGAGACCTTCCTATGTTTTGAGTGGGTCTGCCATGAACGTGGTATTCT
CTGAGGATGAGATGAAAAGGTTTCTTGAGGAGGCCACTCGAGTCTCTCAGGAACACCCGGTGGTGCTGAC
CAAGTTTGTGGAGGGGGCCCGGGAAGTAGAGATGGACGCTGTTGGCAAAGAAGGACGGGTCATCTCCCAT
GCCATCTCTGAACATGTTGAAGATGCAGGTGTCCACTCAGGAGATGCCACCCTGATGCTACCTACACAGA
CCATCAGCCAAGGAGCCATTGAAAAGGTGAAGGATGCCACACGAAAGATTGCAAAAGCCTTTGCCATCTC
TGGGCCATTCAATGTCCAGTTTCTTGTCAAAGGAAATGATGTCTTGGTGATTGAGTGCAATCTGAGAGCA
TCAAGATCCTTCCCCTTTGTCTCCAAGACTCTTGGGGTGGACTTCATTGACGTGGCTACAAAGGTGATGA
TCGGGGAGAGCATTGATGAGAAGCGACTTCCCACGCTGGAGCAGCCCATCATTCCCTCTGACTATGTTGC
CATTAAGGCTCCAATGTTTTCCTGGCCCCGACTGAGAGATGCTGACCCTATTCTGAGATGTGAGATGGCT
TCTACTGGAGAGGTGGCGTGCTTCGGCGAGGGCATTCATACCGCCTTCCTAAAGGCCATGCTGTCTACAG
GGTTTAAGATACCTCAGAAGGGCATTCTGATTGGAATCCAGCAATCATTCCGTCCAAGATTCCTTGGTGT
TGCTGAGCAGTTGCACAATGAAGGTTTCAAGCTTTTTGCCACAGAAGCTACATCAGACTGGCTCAATGCC
AACAATGTCCCTGCCACCCCTGTGGCTTGGCCATCTCAGGAAGGACAGAATCCCAGCCTCTCTTCCATCA
GAAAGTTGATAAGAGATGGAAGCATTGACCTAGTGATTAACCTCCCCAATAACAACACCAAATTTGTCCA
TGATAATTACGTGATTCGGAGGACAGCTGTGGACAGTGGAATTGCTCTCCTCACCAATTTCCAGGTGACC
AAACTTTTTGCTGAAGCTGTGCAGAAATCTCGCACTGTGGACTCCAAGAGTCTGTTCCACTACAGGCAGT
ACAGTGCTGGAAAGGCCGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR222149 representing NM_001080809
Red=Cloning site Green=Tags(s)

MTRILTACKVVKTLKSGFGFANVTTKRQWDFSRPGIRLLSVKAKTAHIVLEDGTKMKGYSFGHPSSVAGE
VVFNTGLGGYPEALTDPAYKGQILTMANPIIGNGGAPDTTARDELGLNKYMESDGIKVAGLLVLNYSNDY
NHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQSVDFVDPNKQNLIAEVSTKDVK
VFGKGNPTKVVAVDCGIKNNVIRLLVKRGAEVHLVPWNHDFTQMEYDGLLIAGGPGNPALAQPLIQNVKK
ILESDRKEPLFGISTGNIITGLAAGAKSYKMSMANRGQNQPVLNITNRQAFITAQNHGYALDNTLPAGWK
PLFVNVNDQTNEGIMHESKPFFAVQFHPEVSPGPTDTEYLFDSFFSLIKKGKGTTITSVLPKPALVASRV
EVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADAVYFLPITPQ
FVTEVIKAERPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLNEINEK
IAPSFAVESMEDALKAADTIGYPVMIRSAYALGGLGSGICPNKETLIDLGTKAFAMTNQILVERSVTGWK
EIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVVAPAQTLSNAEFQMLRRTSVNVVRHLGIVGECNIQ
FALHPTSMEYCIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMV
TKIPRWDLDRFHGTSSRIGSSMKSVGEVMAIGRTFEESFQKALRMCHPSVDGFTPRLPMNKEWPANLDLK
KELSEPSSTRIYAIAKALENNMSLDEIVRLTSIDKWFLYKMRDILNMDKTLKGLNSDSVTEETLRKAKEI
GFSDKQISKCLGLTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTNYLYVTYNGQEHDIKFDEHGIMVLG
CGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQEACN
GCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFAN
SVGYPCLLRPSYVLSGSAMNVVFSEDEMKRFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKEGRVISH
AISEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGNDVLVIECNLRA
SRSFPFVSKTLGVDFIDVATKVMIGESIDEKRLPTLEQPIIPSDYVAIKAPMFSWPRLRDADPILRCEMA
STGEVACFGEGIHTAFLKAMLSTGFKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNA
NNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIALLTNFQVT
KLFAEAVQKSRTVDSKSLFHYRQYSAGKAA

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001080809
ORF Size 4500 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001080809.1, NM_001080809.2, NP_001074278
RefSeq Size 4704
RefSeq ORF 4503
Locus ID 227231
Cytogenetics 1 C3|1 33.75 cM
MW 165.1 kDa
Gene Summary This gene encodes a protein localized to the inner mitochondrial matrix. The encoded protein plays a role in the detoxification of ammonia by catalyzing the first step in the urea cycle in which carbomyl-phosphate is synthesized from ammonia and bicarbonate. Carbamoyl-phosphate is subsequently converted to urea that is excreted by the kidneys. Deficiency of the encoded enzyme leads to an accumulation of ammonia in the blood. High levels of ammonia are toxic to the central nervous system and result in neurological disorders. [provided by RefSeq, Oct 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)