Emd (NM_007927) Mouse Tagged ORF Clone

CAT#: MR222146

Emd (Myc-DDK-tagged) - Mouse emerin (Emd)

Change vector?

  • TrueORF®

USD 98

USD 390


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Emd (NM_007927) Mouse Tagged ORF Clone
Symbol Emd
Synonyms AW550900; Sta
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR222146 representing NM_007927
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGACTATGCGGTTTTGTCCGATACTGAGCTGGCCGCAGTGCTACGCCAGTACAACATCCCTCATG
GGCCTATTGTGGGTTCCACTCGCAAGCTCTACGAAAAGAAAATCTTCGAGTACGAGACCCAGAGAAGGAG
ACTCTTACCCCCCAACTCGTCATCTTCTTCATTCTCCTATCAGTTCTCAGACTTGGATTCAGCCGCCGTG
GACTCAGACATGTATGATCTGCCCAAAAAAGAAGACGCCTTACTTTACCAGAGCAAGGACTATAATGATG
ACTACTATGAGGAGAGTTATTTGACCACCAAGACATACGGGGAGCCTGAGTCTGTGGGCATGTCCAAGAG
CTTCCGCCAGCCGGGGACCTCACTTGTAGATGCTGATACCTTCCATCACCAGGTGCGTGATGACATTTTC
TCTTCTTTAGAAGAGGAAGGCAAGGATAGGGAGCGCCTCATCTATGGCCAAGACAGTGCCTACCAGAGCA
TCGCACACTACCGCCCCATTTCCAATGTCTCCAGGAGCTCTCTGGGCTTATCATATTATCCTACATCCTC
CACCTCTTCTGTGTCCTCCTCTTCATCTTCTCCCTCTTCATGGCTTACCCGACGTGCCATTCGGCCAGAG
AAGCAGGCCCCTGCTGCTGCTCTGGGCCAGGATCGACAGGTCCCACTCTGGGGCCAGCTGTTACTCTTCC
TGGTCTTTGCTGCCTTTCTGCTCTTTGTTTACTATTCCATACAAGCTGAAGAAGGCAACCCCTTCTGGAT
GGATCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR222146 representing NM_007927
Red=Cloning site Green=Tags(s)

MDDYAVLSDTELAAVLRQYNIPHGPIVGSTRKLYEKKIFEYETQRRRLLPPNSSSSSFSYQFSDLDSAAV
DSDMYDLPKKEDALLYQSKDYNDDYYEESYLTTKTYGEPESVGMSKSFRQPGTSLVDADTFHHQVRDDIF
SSLEEEGKDRERLIYGQDSAYQSIAHYRPISNVSRSSLGLSYYPTSSTSSVSSSSSSPSSWLTRRAIRPE
KQAPAAALGQDRQVPLWGQLLLFLVFAAFLLFVYYSIQAEEGNPFWMDP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007927
ORF Size 777 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007927.1, NM_007927.2, NM_007927.3, NP_031953
RefSeq Size 1303
RefSeq ORF 780
Locus ID 13726
Cytogenetics X A7.3|X 37.92 cM
MW 29.9 kDa
Gene Summary This gene is the founding member of the LEM (Lap2beta, Emerin, and Man1) domain gene family. It encodes an integral membrane protein of the inner nuclear membrane. This gene may be involved in transcriptional regulation and genomic organization. In humans, mutations in this gene cause a class of diseases called laminopathies, which includes Emery-Dreifuss muscular dystrophy (EDMD). [provided by RefSeq, Apr 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations