H2-Q7 (NM_010394) Mouse Tagged ORF Clone

CAT#: MR221641

Reviews ()
Write a review
  • TrueORF®

H2 (Myc-DDK-tagged) - Mouse histocompatibility 2, Q region locus 7 (H2-Q7), transcript variant 1



  "NM_010394" in other vectors (4)

Interest in protein/lysate? Submit request here!

USD 350.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name H2-Q7 (NM_010394) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol H2-Q7
Synonyms H-2Q7; Ped; Q9; Qa-2; Qa-7; Qa7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR221641 representing NM_010394
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCTAACAATGCTGCTCTTGCTGGTGGCGGCCGCCCTGACCCTGATCGAGACCCGCGCGGGCCAAC
ACTCGCTGCAATATTTCCACACCGCTGTGTCCCGGCCCGGCCTCGGGGAGCCCTGGTTCATCTCTGTCGG
CTACGTGGACGACACGCAGTTCGTGCGCTTCGACAGCGATGCGGAAAATCCGAGGATGGAGCCGCGGGCG
CGGTGGATGGAGCAGGAGGGGCCGGAGTATTGGGAGCGGGAGACACAGATCGCCAAGGGCCATGAGCAGA
GTTTCCGAGGGAGCCTGAGGACCGCACAGAGCTACTACAACCAGAGCAAGGGCGGCTCTCACACACTCCA
GTGGATGTATGGCTGTGACATGGGGTCCGACGGGCGCCTCCTCCGCGGGTACCTGCAGTTCGCCTATGAA
GGCCGCGATTACATCGCCCTGAACGAAGACCTGAAAACGTGGACGGCGGTGGACATGGCGGCACAGATCA
CCCGACGCAAGTGGGAGCAGGCTGGTATTGCAGAGAAAGACCAGGCCTACCTGGAGGGCACGTGCATGCA
GTCGCTCCGCAGATACCTGCAGCTCGGGAAGGAGACGCTGCTGCGCACAGATCCCCCAAAGGCACATGTG
ACCCATCACCCCAGGTCTTATGGTGCTGTCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCTGACA
TCACCCTGACTTGGCAGTTGAATGGGGAGGAGCTGACCCAGGACATGGAGCTTGTGGAGACCAGGCCTGC
AGGGGATGGAACCTTCCAGAAGTGGGCATCTGTGGTGGTGCCTCTTGGGAAGGAGCAGAATTACACATGC
CATGTGAACCATGAGGGGCTGCCTGAGCCCCTTACCCTGAGATGGGGGAGATGGGAGCCTCCTCCATACA
CTGTCTCCAACATGGCGACCATTGCTGTTGTGGTTGACCTTGGAGCTGTGGCCATCATTGGAGCTGTGGT
GGCTTTTGTGATGAATAGGAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR221641 representing NM_010394
Red=Cloning site Green=Tags(s)

MALTMLLLLVAAALTLIETRAGQHSLQYFHTAVSRPGLGEPWFISVGYVDDTQFVRFDSDAENPRMEPRA
RWMEQEGPEYWERETQIAKGHEQSFRGSLRTAQSYYNQSKGGSHTLQWMYGCDMGSDGRLLRGYLQFAYE
GRDYIALNEDLKTWTAVDMAAQITRRKWEQAGIAEKDQAYLEGTCMQSLRRYLQLGKETLLRTDPPKAHV
THHPRSYGAVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTC
HVNHEGLPEPLTLRWGRWEPPPYTVSNMATIAVVVDLGAVAIIGAVVAFVMNRR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_010394
ORF Size 1002 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_010394.1, NM_010394.2, NM_010394.3, NM_010394.4, NP_034524.3
RefSeq Size 1536 bp
RefSeq ORF 1005 bp
Locus ID 15018
Cytogenetics 17 18.67 cM
MW 37.9 kDa
Gene Summary Involved in the presentation of foreign antigens to the immune system. [UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "H2-Q7"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools