Klf14 (NM_001135093) Mouse Tagged ORF Clone

CAT#: MR221172

Klf14 (Myc-DDK-tagged) - Mouse Kruppel-like factor 14 (Klf14)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 219.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Klf14 (NM_001135093) Mouse Tagged ORF Clone
Symbol Klf14
Synonyms 5330411L03Rik; AL022736; BTEB5
Vector pCMV6-Entry
Sequence Data
>MR221172 representing NM_001135093
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGCCGCCGTGGCTTGCCTGGACTACTTCGCTGCCGAGTGCCTGGTGTCTATGTCCACCCGCGCCG
TGCTGCACCGGCGCGCAACGGACCCCGAAGGCGCGAGCGCAGCGGCTGTCTCCGAGGTGGGTGCAGTGTC
TCGGGAGTCGGCGGGGAAGGGTACCGGGTCACGGGGGGTGCTGTGGATACCCCCAGTCCTCCAGGTCCCC
ACCCCGAGCCCCGGAGAAGGCGATGGCGCGCCCCACCTGCTGGCTGCGAGCGCTTTGGCTGATTTAAGCT
GTGGTGCCCGGGAAGACTTCAGGGAAGACTCCGAAGAAGCTCCGTGTGCCTCAACTAGCTGCTTCGAGCC
GACCTGGTGCTCCAGCCCTACTGGGGGCTCTGAGCCTACCCAGGCCTTCTTCGAGGATGAGCTCTCTGAC
GCCGAGAGCTCCTGCAGTGATTCTGCTATCCTGGATGCGCCTGAGGCCTCAGAGGAGCCGGATGACAGCG
GAGAAGTGCCCGAGGGGCCCCCAGGGGCCCGCCCTGCGCCATCAACGGGCCCGACGTACCGAAGGAGGCA
GATTACGCCCGCATCCAAGCGACATCAGTGCTCCTTCCATGGCTGCAACAAGGCCTACTACAAGTCGTCG
CACCTCAAGTCACACCAGCGTACCCACACGGGGGAACGCCCCTTCTCCTGTGATTGGCTCGACTGCGACA
AGAAGTTTACGCGTTCTGATGAGCTAGCCCGCCACTACAGGACGCACACCGGTGAAAAGCGCTTCTCCTG
CCCGCTGTGTCCCAAGCAGTTCTCTCGGAGCGACCACCTGACCAAGCATGCTCGTCGCCATCCAACTTAC
CATCCCGACATGATCGAGTACCGAGGTCGTCGTCGCACTCCCCGCCCTGAGCCACCACCCCCAGCCATGG
TGGAAAGCTCTGGTTCCGACTCCAGCTCCTCTTCTGGCCAGGAGACCAGCTTCACTGCTTGCCTG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>MR221172 representing NM_001135093
Red=Cloning site Green=Tags(s)

MSAAVACLDYFAAECLVSMSTRAVLHRRATDPEGASAAAVSEVGAVSRESAGKGTGSRGVLWIPPVLQVP
TPSPGEGDGAPHLLAASALADLSCGAREDFREDSEEAPCASTSCFEPTWCSSPTGGSEPTQAFFEDELSD
AESSCSDSAILDAPEASEEPDDSGEVPEGPPGARPAPSTGPTYRRRQITPASKRHQCSFHGCNKAYYKSS
HLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTY
HPDMIEYRGRRRTPRPEPPPPAMVESSGSDSSSSSGQETSFTACL

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001135093
ORF Size 975 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001135093.1, NP_001128565
RefSeq Size 2970
RefSeq ORF 978
Locus ID 619665
Cytogenetics 6|6 A3.3
MW 35.5 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)