Camk2b (NM_007595) Mouse Tagged ORF Clone

CAT#: MR220945

Camk2b (Myc-DDK-tagged) - Mouse calcium/calmodulin-dependent protein kinase II, beta (Camk2b), transcript variant 2

Change vector?

  • TrueORF®

USD 691


Availability*
4 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Camk2b (NM_007595) Mouse Tagged ORF Clone
Symbol Camk2b
Synonyms CaMKII
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR220945 representing NM_007595
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACCACGGTGACCTGCACCCGTTTCACCGACGAGTACCAGCTATACGAGGATATTGGCAAGGGGG
CTTTCTCTGTGGTCCGACGCTGTGTCAAGCTCTGTACCGGCCATGAGTATGCAGCCAAGATCATTAATAC
CAAGAAGCTGTCGGCCAGAGATCACCAGAAACTGGAGAGAGAAGCTCGGATCTGCCGCCTGCTGAAGCAT
TCCAACATTGTACGCCTCCATGACAGCATCTCTGAAGAGGGCTTCCACTACCTGGTCTTCGATCTGGTCA
CTGGTGGGGAGCTCTTTGAAGACATCGTGGCAAGAGAGTACTACAGTGAAGCTGATGCCAGTCACTGCAT
CCAGCAGATCCTGGAAGCTGTTCTCCATTGTCACCAAATGGGGGTCGTCCACAGAGACCTCAAGCCTGAG
AACCTGCTTCTGGCCAGCAAATGCAAAGGCGCCGCAGTGAAGCTGGCAGACTTCGGCCTGGCCATCGAGG
TTCAGGGAGACCAGCAGGCATGGTTTGGATTTGCGGGAACGCCAGGCTACCTGTCTCCCGAGGTCCTTCG
GAAGGAGGCCTACGGCAAACCTGTGGACATCTGGGCATGTGGGGTGATCCTGTATATCCTGCTGGTGGGC
TACCCACCTTTCTGGGATGAGGACCAACACAAGCTGTACCAGCAGATCAAGGCTGGGGCGTATGATTTCC
CATCCCCTGAGTGGGACACCGTTACTCCTGAAGCCAAAAACCTCATCAACCAGATGCTGACCATCAACCC
TGCCAAGCGCATCACGGCCCATGAGGCCCTGAAGCACCCATGGGTCTGCCAACGTTCCACCGTGGCCTCT
ATGATGCACAGACAGGAGACTGTGGAATGTCTGAAGAAGTTCAATGCAAGGAGGAAGCTCAAGGGAGCCA
TCCTCACCACTATGCTGGCCACACGGAATTTCTCAGTGGGCAGACAGACCACCGCTCCGGCCACAATGTC
CACCGCGGCCTCCGGCACCACCATGGGGCTGGTGGAACAAGCCAAGAGTTTACTCAACAAGAAAGCAGAT
GGAGTCAAGCCCCAGACAAACAGCACCAAAAACAGCTCGGCCATCACCAGCCCCAAAGGATCTCTCCCTC
CTGCTGCCCTGGAGCCTCAAACCACCGTTATCCATAACCCAGTGGACGGGATTAAGGAATCTTCCGACAG
CACCAACACAACCATAGAGGATGAAGATGCCAAAGCCCGGAAGCAGGAAATCATCAAGACCACAGAGCAG
CTCATTGAGGCCGTCAACAATGGGGACTTTGAGGCCTATGCGAAAATCTGTGACCCAGGCCTGACCTCAT
TTGAGCCTGAAGCTCTGGGCAACCTGGTCGAAGGGATGGATTTCCACAGATTCTACTTTGAGAACCTGCT
GGCCAAGAACAGCAAGCCGATCCACACCACCATCCTGAACCCGCACGTGCACGTCATTGGCGAGGATGCG
GCATGCATCGCCTACATCCGCCTCACACAGTACATCGATGGCCAGGGCAGACCCCGTACCAGCCAGTCCG
AAGAGACCCGTGTGTGGCACCGCCGCGACGGCAAGTGGCAGAATGTACATTTCCACTGCTCGGGCGCTCC
AGTGGCCCCGCTGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR220945 representing NM_007595
Red=Cloning site Green=Tags(s)

MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKH
SNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPE
NLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEAYGKPVDIWACGVILYILLVG
YPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVAS
MMHRQETVECLKKFNARRKLKGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKAD
GVKPQTNSTKNSSAITSPKGSLPPAALEPQTTVIHNPVDGIKESSDSTNTTIEDEDAKARKQEIIKTTEQ
LIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDA
ACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPLQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007595
ORF Size 1626 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007595.1, NM_007595.2, NM_007595.3, NM_007595.4, NM_007595.5, NP_031621
RefSeq Size 4025
RefSeq ORF 1629
Locus ID 12323
Cytogenetics 11 A1|11 3.89 cM
MW 60.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations