Gje1 (NM_029722) Mouse Tagged ORF Clone

CAT#: MR220757

Gje1 (Myc-DDK-tagged) - Mouse gap junction protein, epsilon 1 (Gje1)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 149.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Gje1 (NM_029722) Mouse Tagged ORF Clone
Symbol Gje1
Synonyms AEY12; Cx23; D230044M03Rik; Gjf1; Gsfaey12
Vector pCMV6-Entry
Sequence Data
>MR220757 representing NM_029722
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCTAAATTACATCAAGAACTTCTATGAAGGATGTGTTAAGCCTCCAACTGTGATCGGCCAGTTCC
ACACTCTCTTCTTCGGCTCAGTGCGGATGTTCTTCCTCGGAGTGCTGGGCTTTGCTGTCTACGGGAATGA
GGCGTTGCACTTCAGCTGTGACCCAGACAAGCGAGAGATAAACCTGTTCTGTTACAATCAGTTCCGGCCA
ATAACTCCCCAAGTGTTCTGGGCATTGCAGCTAGTGATTGTCCTGCTTCCTGGAGCTATTTTCCACCTGT
ATGCTGCATGCAAAAGCATCAATCAAGACTGCATTCTTCAGAAGCCCGTGTACACTGTGATTTACGTCCT
CTCGGTCTTGTTAAGAATCAGCCTGGAGGTGTTCGCATTCTGGCTTCAGATTCACCTCTTCGGCTTCCAA
GTGAAGCCGATATACTTGTGTGATACTGAATCTCTTGGTAAAAAACCAAATATTCTAAAATGCATGGTTC
CAGAGCACTTTGAAAAGACTATTTTCCTCATTGCAATGTACACATTTACTGTGATCACGATGGTATTATG
TGTTGCTGAGGTTTTTGAGATCATATTTAGAAGATCATGTTTTCTCTTTAAACGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR220757 representing NM_029722
Red=Cloning site Green=Tags(s)

MSLNYIKNFYEGCVKPPTVIGQFHTLFFGSVRMFFLGVLGFAVYGNEALHFSCDPDKREINLFCYNQFRP
ITPQVFWALQLVIVLLPGAIFHLYAACKSINQDCILQKPVYTVIYVLSVLLRISLEVFAFWLQIHLFGFQ
VKPIYLCDTESLGKKPNILKCMVPEHFEKTIFLIAMYTFTVITMVLCVAEVFEIIFRRSCFLFKR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_029722
ORF Size 615 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_029722.1, NP_083998
RefSeq Size 1477
RefSeq ORF 618
Locus ID 76743
Cytogenetics 10|10 A2
MW 24.3 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)