Awat2 (NM_177746) Mouse Tagged ORF Clone

CAT#: MR219385

Awat2 (Myc-DDK-tagged) - Mouse acyl-CoA wax alcohol acyltransferase 2 (Awat2)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 269.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Awat2 (NM_177746) Mouse Tagged ORF Clone
Symbol Awat2
Synonyms 9430062J17Rik; ARAT; Dgat2l4; WS
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR219385 representing NM_177746
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCTGGCCCACCAAGAAGGACCTCAAGACCGCCATGGAGGTCTTTGCTCTTTTCCAGTGGGCCCTCA
GTGCCTTGGTTATAGTCACCACTGTGATCATTGTCAACCTCTACTTGGTGGTGTTCACATCTTACTGGCC
TGTCACCGTGTTGATGCTCACCTGGCTGGCTTTTGACTGGAAGACCCCTGAGCGAGGTGGCCGCAGGTTC
ACCTGTGTGAGGAAGTGGCGTCTGTGGAAACACTATAGCGACTACTTCCCACTCAAGATGGTGAAGACGA
AAGATATTTCACCTGACCGCAACTACATCCTTGTCTGCCATCCTCATGGGCTCATGGCCCATTCATGTTT
TGGTCACTTTGCCACTGACACAACAGGCTTTTCCAAGACCTTTCCTGGTATCACTCCTTATATGCTCACA
CTAGGAGCCTTTTTCTGGGTACCTTTCCTCAGAGATTATGTAATGTCTACAGGGTCGTGCTCTGTGAGTA
GATCCTCCATGGACTTTTTGCTTACCCAGAAGGGCACAGGCAACATGCTTGTGGTGGTGGTTGGTGGCCT
GGCTGAGTGCAGATACAGCACGCCAGGCTCTACCACCCTGTTCTTGAAGAAGCGGCAAGGCTTTGTGCGC
ACAGCCCTTAAACATGGGGTGTCTCTAATCCCAGCTTATGCCTTTGGAGAGACAGACCTCTATGACCAGC
ACATTTTCACTCCTGGGGGCTTTGTCAATCGCTTCCAGAAGTGGTTCCAGAAGATGGTACACATCTACCC
CTGTGCTTTCTATGGGCGTGGCCTCACCAAGAACTCCTGGGGCCTTCTGCCCTATTCTCAGCCAGTAACC
ACTGTTGTTGGAGAACCTCTACCATTGCCCAAGATTGAGAATCCGAGCGAGGAGATTGTGGCCAAATACC
ACACACTCTATATTGATGCCCTACGAAAATTGTTTGATCAGCATAAGACCAAGTTTGGCATCTCAGAGAC
CCAGGAGCTGGTGATAGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR219385 representing NM_177746
Red=Cloning site Green=Tags(s)

MFWPTKKDLKTAMEVFALFQWALSALVIVTTVIIVNLYLVVFTSYWPVTVLMLTWLAFDWKTPERGGRRF
TCVRKWRLWKHYSDYFPLKMVKTKDISPDRNYILVCHPHGLMAHSCFGHFATDTTGFSKTFPGITPYMLT
LGAFFWVPFLRDYVMSTGSCSVSRSSMDFLLTQKGTGNMLVVVVGGLAECRYSTPGSTTLFLKKRQGFVR
TALKHGVSLIPAYAFGETDLYDQHIFTPGGFVNRFQKWFQKMVHIYPCAFYGRGLTKNSWGLLPYSQPVT
TVVGEPLPLPKIENPSEEIVAKYHTLYIDALRKLFDQHKTKFGISETQELVIV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_177746
ORF Size 999 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_177746.3, NM_177746.4, NP_808414
RefSeq Size 1607
RefSeq ORF 1002
Locus ID 245532
Cytogenetics X|X C3
MW 38.6 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)