Rasl12 (NM_001162923) Mouse Tagged ORF Clone

CAT#: MR219049

  • TrueORF®

Rasl12 (Myc-DDK-tagged) - Mouse RAS-like, family 12 (Rasl12), transcript variant 2

  View "NM_001162923" in other vectors (6)

Interest in protein/lysate? Sumbit request here!

USD 330.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Rasl12 (NM_001162923) Mouse Tagged ORF Clone
Symbol Rasl12
Synonyms 4631404I11Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR219049 representing NM_001162923
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGTCGGTGTTCGGCAAGCCCCGAGCTGGCAGCGGGCCGCACAGCGTGCCCCTGGAAGTTAACCTGG
CTATCCTTGGGCGCCGCGGAGCGGGCAAGTCTGCCCTGACGGTGAAGTTCCTCACCAAGAGGTTTATCAG
CGAATATGATCCCAATTTGGAGGACACCTACAGCTCTGAGGAGACTGTGGACCACCAGCCTGTGCACCTG
AGGGTCATGGACACTGCAGACCTGGACACCCCCAGGAACTGCGAGCGCTACCTGAACTGGGCCCATGCCT
TCTTGGTGGTGTATAGTGTCGATAGTCGTGCGAGTTTCGAGGGCAGCAGCAGCTACCTAGAGCTGCTGGC
CTTGCATGCCAAGGAGACACAACGTGGCTACCCTGCTCTGCTGCTGGGCAACAAGCTTGACATGGCCCAG
TACAGGTTTACCCACACCACTGGACATGCGTGTAAGACCCAATCCTACGCATGGCTCCCACTGCCTCCTC
AACCTGACAGTCCTTCTAATAATCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR219049 representing NM_001162923
Red=Cloning site Green=Tags(s)

MSSVFGKPRAGSGPHSVPLEVNLAILGRRGAGKSALTVKFLTKRFISEYDPNLEDTYSSEETVDHQPVHL
RVMDTADLDTPRNCERYLNWAHAFLVVYSVDSRASFEGSSSYLELLALHAKETQRGYPALLLGNKLDMAQ
YRFTHTTGHACKTQSYAWLPLPPQPDSPSNNP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001162923
ORF Size 516 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001162923.1, NP_001156395
RefSeq Size 1949
RefSeq ORF 519
Locus ID 70784
Cytogenetics 9|9 C
MW 19.6 kDa

Other Versions

Other products for "Rasl12"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones