Mthfr (NM_001161798) Mouse Tagged ORF Clone

CAT#: MR217757

Reviews ()
Write a review
  • TrueORF®

Mthfr (Myc-DDK-tagged) - Mouse 5,10-methylenetetrahydrofolate reductase (Mthfr), transcript variant 1



  "NM_001161798" in other vectors (4)

Interest in protein/lysate? Submit request here!

Special Offer: 20% off on control vector. Use code "Shuttle20".

USD 828.00


Availability*
4 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Mthfr
Synonyms AI323986
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR217757 representing NM_001161798
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCATCAAAAAGCCAAGGTCCTCCCAGCTGGGCACTGTTATCCATCCCTGGGGATGTGGGCCTCAG
AGGCTGGCTGCGTGAGGCTTTCTGTGCCACCCTCTATCAGCAGGAATCCAGCCATGGTGAACGAGGCCAG
AGGAAGTGGCAGTCCCAACCCGCGATCTGAGGGCAGCAGCAGTGGCAGCGAGAGTTCCAAGGACAGTTCA
AGATGTTCCACCCCCAGCCTGGACCCAGAGCGGCACGAGAGACTCCGGGAGAAGATGAGGCGCAGAATGG
ACTCTGGTGACAAGTGGTTCTCCCTGGAGTTCTTCCCCCCTCGAACTGCTGAGGGAGCTGTTAACCTCAT
CTCCAGGTTTGACCGGATGGCAGCAGGGGGCCCCCTCTTCGTAGATGTTACCTGGCACCCAGCTGGAGAC
CCTGGCTCAGACAAGGAGACCTCCTCCATGATGATCGCCAGCACAGCAGTAAACTACTGCGGCTTGGAAA
CCATCCTGCATATGACCTGCTGCCAGCAGCGCCCGGAGGAGATCACAGGCCATCTGCACAGAGCCAAGCA
GCTGGGCCTGAAGAACATAATGGCGCTGAGGGGAGACCCTGTAGGTGACCACTGGGAAGCAGAGGAAGGA
GGCTTCAGCTATGCCACAGACCTGGTGAAGCACATCCGGACCGAGTTTGCTGACTATTTTGACATCTGTG
TGGCAGGTTACCCCAGAGGCCACCCCGATGCAGAGAGCTTCGAGGATGACCTGAAGCATTTGAAGGAGAA
GGTATCTGCAGGCGCCGACTTCATTATCACTCAGCTCTTCTTTGAGGCCAGCACCTTCTTCAGCTTTGTG
AAGGCCTGCACAGAGATAGGCATCTCTTGCCCTATCCTGCCTGGGATCTTCCCTATTCAGGGCTACACTT
CCCTTCGGCAGCTTGTAAAACTGTCCAAGCTGGAGGTGCCACAGAAGATCAAGGATGTAATTGAGCCCAT
CAAAGACAACGATGCTGCCATCCGCAACTACGGCATTGAGCTGGCTGTAAGCCTGTGCCGGGAGCTGCTG
GACAGTGGCTTGGTGCCAGGCCTCCACTTCTATACCCTCAACCGCGAGGTGGCCACCATGGAGGTGCTAA
AGCAACTGGGCATGTGGACCGAGGACCCCAGGCGTCCCTTGCCCTGGGCTCTCAGTGCGCATCCCAAGCG
CCGGGAGGAAGATGTCCGTCCCATCTTCTGGGCCTCCAGACCAAAGAGCTACATCTACCGCACACAGGAC
TGGGATGAGTTTCCTAACGGCCGCTGGGGTAATTCTTCCTCACCAGCCTTTGGGGAGCTGAAAGACTACT
ACCTCTTCTACCTGAAAAGCAAGTCCCCCAGGGAGGAGCTGCTGAAGATGTGGGGCGAGGAGCTCACCAG
CGAAGAGAGTGTCTTTGAAGTCTTTGAACACTACCTCTCTGGAGAGCCGAATCGCCATGGCTACAGAGTA
ACCTGCCTGCCCTGGAACGATGAACCCCTGGCAGCGGAAACCAGCCTGATGAAGGAAGAGCTGCTCCGCG
TGAACAGGCTGGGCATCCTCACCATCAACTCTCAGCCCAACATCAACGCAAAACCATCCTCAGACCCTGT
TGTGGGCTGGGGCCCCAGTGGGGGTTATGTCTTCCAGAAGGCCTACCTCGAATTCTTCACCTCCCGTGAA
ACTGTGGAGGCGCTTCTGCAGGTGCTGAAGACATACGAGCTGCGGGTCAACTACCACATCGTGGACGTGA
AGGGAGAGAACATCACTAATGCCCCTGAGCTGCAGCCCAATGCCGTGACGTGGGGCATCTTCCCGGGTCG
AGAGATCATCCAGCCTACTGTGGTGGACCCCATCAGCTTCATGTTCTGGAAGGATGAGGCCTTTGCCCTG
TGGATCGAGCAGTGGGGCAAGCTATACGAGGAGGAGTCGCCATCCCGCATGATCATCCAATACATCCATG
ACAACTATTTCCTGGTCAACCTGGTGGACAACGAGTTCCCGCTGGACAGCTGCCTGTGGCAGGTGGTGGA
GGACACGTTTGAGCTGCTCAACAGGCATCCCACGGAGAGAGAGACACAGGCTCCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR217757 representing NM_001161798
Red=Cloning site Green=Tags(s)

MNHQKAKVLPAGHCYPSLGMWASEAGCVRLSVPPSISRNPAMVNEARGSGSPNPRSEGSSSGSESSKDSS
RCSTPSLDPERHERLREKMRRRMDSGDKWFSLEFFPPRTAEGAVNLISRFDRMAAGGPLFVDVTWHPAGD
PGSDKETSSMMIASTAVNYCGLETILHMTCCQQRPEEITGHLHRAKQLGLKNIMALRGDPVGDHWEAEEG
GFSYATDLVKHIRTEFADYFDICVAGYPRGHPDAESFEDDLKHLKEKVSAGADFIITQLFFEASTFFSFV
KACTEIGISCPILPGIFPIQGYTSLRQLVKLSKLEVPQKIKDVIEPIKDNDAAIRNYGIELAVSLCRELL
DSGLVPGLHFYTLNREVATMEVLKQLGMWTEDPRRPLPWALSAHPKRREEDVRPIFWASRPKSYIYRTQD
WDEFPNGRWGNSSSPAFGELKDYYLFYLKSKSPREELLKMWGEELTSEESVFEVFEHYLSGEPNRHGYRV
TCLPWNDEPLAAETSLMKEELLRVNRLGILTINSQPNINAKPSSDPVVGWGPSGGYVFQKAYLEFFTSRE
TVEALLQVLKTYELRVNYHIVDVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPISFMFWKDEAFAL
WIEQWGKLYEEESPSRMIIQYIHDNYFLVNLVDNEFPLDSCLWQVVEDTFELLNRHPTERETQAP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001161798
ORF Size 2085 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001161798.1, NP_001155270.1
RefSeq Size 6085 bp
RefSeq ORF 2088 bp
Locus ID 17769
Cytogenetics 4 78.67 cM
MW 79.4 kDa
Gene Summary Catalyzes the conversion of 5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate, a co-substrate for homocysteine remethylation to methionine.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "Mthfr"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.