Adam33 (NM_033615) Mouse Tagged ORF Clone

CAT#: MR217277

Adam33 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 33 (Adam33), transcript variant 1

Change vector?

  • TrueORF®

USD 98

USD 990


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Adam33 (NM_033615) Mouse Tagged ORF Clone
Symbol Adam33
Synonyms Adaml
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR217277 representing NM_033615
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTCGAGGTGCGGGAGACCCGGGGGGTCTCCGGTGCTGCTATTGCTGCCGCTGTTGCTGCCCTCGT
GTCCGCTGCGGAGCGCTCGGATGTTTCCAGGAAATGCCCATGGAGAGCTAGTCACTCCCCACTGGATCCT
GGAGGGCAGACTCTGGCTCAAGGTCACCCTGGAGGAGCCGATCTTGAAGCCTGACTCGGTGCTGGTGGCT
TTAGAGGCTGAAGGCCAGGATCTCCTGCTTGAACTGGAGAAGAAGCACAAGCTTCTGGCCCCAGGATACA
CAGAAACCCACTACAGGCCAGATGGGCATCCGGTAGTGCTGTCCCCCAACCACACGGATCATTGCCAATA
TCACGGGCGTGTGAGGGGCTTCCGGGAATCCTGGGTGGTTCTCAGCACCTGCTCTGGGATGAGTGGCCTT
ATTGTGCTCAGCAGCAAAGTCAGCTATTATCTGCAACCTCGGACTCCTGGGGATACCAAAGACTTCCCAA
CCCACGAGATCTTCCGGATGGAGCAGTTGTTCACCTGGAGAGGGGTCCAGAGAGACAAGAACTCCCAATA
CAAAGCAGGAATGGCCAGTCTTCCTCATGTCCCCCAGAGCCGGGTGAGGCGAGAGGCGCGCAGGAGTCCC
AGGTACCTGGAACTGTACATAGTGGCTGACCACACCCTGTTCTTGCTTCAGCATCAGAACTTGAACCACA
CGAGACAGCGCCTCCTGGAGGTTGCCAATTGCGTGGACCAGATTCTCAGGACTCTGGATATACAGTTGGT
GTTGACCGGGCTGGAAGTGTGGACCGAGCAGGATCTCAGTCGCATCACTCAGGACGCAAACGAAACGCTC
TGGGCTTTCCTACAGTGGCGCCGCGGGGTGTGGGCCAGGAGACCACACGACTCCACACAACTGCTCACGG
GCCGCACCTTCCAGGGTACCACGGTGGGCCTGGCACCTGTGGAGGGCATATGCCGCGCGGAGAGCTCCGG
AGGTGTGAGCACAGACCACTCGGAACTCCCCATCGGCACAGCAGCCACCATGGCCCACGAGATAGGCCAC
AGCCTGGGCCTCCACCATGATCCCGAGGGCTGCTGCGTGCAGGCCGATGCAGAGCAAGGAGGCTGCGTCA
TGGAGGCAGCCACAGGGCACCCTTTCCCGCGCGTCTTCAGCGCCTGCAGCCGCCGCCAGCTGCGCACCTT
CTTCCGCAAAGGGGGCGGTCCTTGCCTCTCCAACACCTCGGCGCCGGGGCTCCTGGTGCTGCCCAGCCGC
TGCGGAAACGGCTTCTTGGAAGCAGGAGAAGAGTGCGACTGCGGTTCTGGCCAGAAGTGCCCAGACCCCT
GCTGCTTTGCCCACAATTGCTCCCTGCGTGCGGGGGCTCAATGTGCCCACGGTGATTGCTGTGCGAGGTG
CCTGTTAAAGTCCGCGGGCACGCCTTGTCGTCCTGCTGCGACTGACTGCGATCTCCCCGAGTTCTGCACC
GGCACCTCCCCGTATTGCCCCGCAGATGTTTACCTACTGGATGGCTCACCCTGCGCTGAGGGTCGCGGCT
ATTGCCTAGACGGCTGGTGTCCCACGCTGGAGCAGCAGTGCCAGCAGCTATGGGGGCCTGGGTCCAAGCC
GGCCCCAGAGCCATGTTTCCAGCAGATGAACTCCATGGGGAATTCGCAAGGGAACTGTGGCCAGGACCAC
AAGGGTAGCTTCCTGCCTTGTGCTCAGAGGGACGCTCTGTGTGGGAAACTGCTGTGCCAGGGAGGGGAGC
CGAACCCACTAGTGCCGCACATAGTGACTATGGACTCCACAATTCTCCTAGAGGGCCGCGAAGTGGTTTG
CCGAGGGGCCTTTGTGCTCCCAGATAGTCACCTGGACCAGCTTGACTTGGGTCTGGTAGAGCCAGGCACC
GGCTGTGGACCTAGAATGGTGTGCCAGGACAGGCACTGTCAGAATGCTACCTCCCAGGAGCTGGAACGTT
GCTTGACTGCCTGCCATAACGGTGGGGTTTGCAATAGCAATCGTAACTGTCACTGTGCTGCTGGCTGGGC
TCCACCCTTCTGTGACAAGCCTGGCTTGGGTGGTAGCGTGGATAGTGGCCCTGCACAGTCTGCAAACCGA
GATGCCTTCCCCTTGGCCATGCTCCTCAGCTTCCTGCTGCCTCTGCTCCCTGGGGCTGGCCTAGCCTGGT
GCTACTACCAGCTCCCAACATTCTGTCATCGAAGGGGACTGTGCTGCAGGAGGGACCCCCTATGGAATAG
AGACATACCCCTGGGCAGTGTGCATCCGGTGGAGTTTGGCTCCATCATCACTGGAGAGCCCTCGCCCCCT
CCCCCATGGACCTCTTGCCAACAGCGTTCGCACCCTCCATCTCTTGACTTGCTCTCAGACCCTGCGAACT
CTGAGCTTACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR217277 representing NM_033615
Red=Cloning site Green=Tags(s)

MGSRCGRPGGSPVLLLLPLLLPSCPLRSARMFPGNAHGELVTPHWILEGRLWLKVTLEEPILKPDSVLVA
LEAEGQDLLLELEKKHKLLAPGYTETHYRPDGHPVVLSPNHTDHCQYHGRVRGFRESWVVLSTCSGMSGL
IVLSSKVSYYLQPRTPGDTKDFPTHEIFRMEQLFTWRGVQRDKNSQYKAGMASLPHVPQSRVRREARRSP
RYLELYIVADHTLFLLQHQNLNHTRQRLLEVANCVDQILRTLDIQLVLTGLEVWTEQDLSRITQDANETL
WAFLQWRRGVWARRPHDSTQLLTGRTFQGTTVGLAPVEGICRAESSGGVSTDHSELPIGTAATMAHEIGH
SLGLHHDPEGCCVQADAEQGGCVMEAATGHPFPRVFSACSRRQLRTFFRKGGGPCLSNTSAPGLLVLPSR
CGNGFLEAGEECDCGSGQKCPDPCCFAHNCSLRAGAQCAHGDCCARCLLKSAGTPCRPAATDCDLPEFCT
GTSPYCPADVYLLDGSPCAEGRGYCLDGWCPTLEQQCQQLWGPGSKPAPEPCFQQMNSMGNSQGNCGQDH
KGSFLPCAQRDALCGKLLCQGGEPNPLVPHIVTMDSTILLEGREVVCRGAFVLPDSHLDQLDLGLVEPGT
GCGPRMVCQDRHCQNATSQELERCLTACHNGGVCNSNRNCHCAAGWAPPFCDKPGLGGSVDSGPAQSANR
DAFPLAMLLSFLLPLLPGAGLAWCYYQLPTFCHRRGLCCRRDPLWNRDIPLGSVHPVEFGSIITGEPSPP
PPWTSCQQRSHPPSLDLLSDPANSELT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_033615
ORF Size 2391 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_033615.1, NM_033615.2, NM_033615.3, NP_291093
RefSeq Size 3165
RefSeq ORF 2394
Locus ID 110751
Cytogenetics 2 F1|2 63.26 cM
MW 87.4 kDa
Gene Summary This gene encodes a member of a disintegrin and metalloprotease (ADAM) family of endoproteases that play important roles in various biological processes including cell signaling, adhesion and migration. This gene is widely expressed, most highly in the adult brain, heart, kidney, lung and testis. The encoded preproprotein undergoes proteolytic processing to generate a mature, functional metalloprotease enzyme. Alternative splicing results in multiple transcript variants encoding different isoforms, some of which may undergo similar processing. [provided by RefSeq, May 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations