Wfdc1 (NM_023395) Mouse Tagged ORF Clone

CAT#: MR217158

Reviews ()
Write a review
  • TrueORF®

Wfdc1 (Myc-DDK-tagged) - Mouse WAP four-disulfide core domain 1 (Wfdc1)


  View "NM_023395" in other vectors (6)

Interest in protein/lysate? Sumbit request here!

USD 68.00

USD 219.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Wfdc1 (NM_023395) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Wfdc1
Synonyms 2310058A03Rik; ps20
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR217158 representing NM_023395
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTAACTGCGGCAGAAAAGTCCTTCGGGCTCTGAGTTTCCTGTTGCTACTGGGCTCCAGTTCTGCCC
AGGGCACTTGGGAGGCAATGCTGCCGGCCAGGCTGGCCGAGAAGTCCCGAGCTGAAGAGGTTGCAGCGAC
AGGCTCCCGGCAGCCCCATGCAGACCGCTGCCCACCACCGCCAAGGACACTGCCCCCGGGTGCCTGTCAG
GCCACACGCTGCCAGGCTGACTCTGAGTGCCCACGACACAGGCGCTGCTGCTACAATGGCTGTGCCTATG
CCTGCCTGGAGGCGGTGCCACCTCCGCCAGTTCTAGACTGGCTGGTGCAGCCCAAACCACGATGGCTGGG
TGGCAACGGCTGGCTGCTGGACGGTCCTGAGGAAGTGTTACAAGCAGAGACTTGCAGCACCACTGAGGAT
GGGGCAGAGCCACTCCTCTGTCCCTCAGGCTATGAGTGCCATATCCTGCAGCCAGGGGACGAAGCCCAGG
GCATACCCAACCATGGACAGTGTGTTAAGCAACGCCGGCAAGCAGAAGGGCGGGTCCTGCGACAGAGGCT
TCACAAGGAATATCCAGAAGGTGACTCCAAGAATGTGGCAGAGCCTGGGAAGGGACAACAGAGGCACTTT
CCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR217158 representing NM_023395
Red=Cloning site Green=Tags(s)

MGNCGRKVLRALSFLLLLGSSSAQGTWEAMLPARLAEKSRAEEVAATGSRQPHADRCPPPPRTLPPGACQ
ATRCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAETCSTTED
GAEPLLCPSGYECHILQPGDEAQGIPNHGQCVKQRRQAEGRVLRQRLHKEYPEGDSKNVAEPGKGQQRHF
P

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_023395
ORF Size 633 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_023395.1, NM_023395.2, NP_075884.1
RefSeq Size 1169
RefSeq ORF 636
Locus ID 67866
Cytogenetics 8 E1
MW 23.5 kDa

Other Versions

Other products for "Wfdc1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Goat Polyclonal Antibody against Wfdc1 (mouse)
    • 100 ug

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Order online and get additional $20 off!
68 Mouse Clones