Rmi2 (NM_001162932) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MR216967
Rmi2 (Myc-DDK-tagged) - Mouse RIKEN cDNA A630055G03 gene (A630055G03Rik)
  $289.00
In Stock*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Rmi2
Synonyms A630055G03Rik; Gm537; Gm929
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR216967 representing NM_001162932
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCTGCGGCGTCCGAGTCGCTGTCCTCCGGTGGCCCCGGGGCCGTGCGGCTGCCGCGCTTGCCGC
CACTCAAGGTACTGGCAGGACAGCTGCGGCGGCACGCAGAGGGTGGCCCGGGCGCGTGGCGGCTGTCGCG
GGCGGCGGTGGGCCGCGCTCCGCTGGAGCTGGTGGCCGTGTGGATGCAGGGTACCGTGCTGGCGGCGGAA
GGCGGCCAGGCCCGGCTGCGCGACTCGAGCGGAGCCTTCTCTGTGCGCGGCCTGGAGCGCGTACCACGCG
GCCGGCCCTGCCTCCTCCCAGGAAAGTATGTGATGGTGATGGGGGTGGTTCAGGCCTGCAGTCCTGAGCC
CTGCCTGCAGGCCGTGAAGATGACGGATCTTTCTGACAATCCTGTCCACGAAAGCATGTGGGAACTGGAG
GTGGAAGATTTACACAGGAATATTCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR216967 representing NM_001162932
Red=Cloning site Green=Tags(s)

MAAAASESLSSGGPGAVRLPRLPPLKVLAGQLRRHAEGGPGAWRLSRAAVGRAPLELVAVWMQGTVLAAE
GGQARLRDSSGAFSVRGLERVPRGRPCLLPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPVHESMWELE
VEDLHRNIP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001162932
ORF Size 447 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001162932.1, NP_001156404.1
RefSeq Size 3739 bp
RefSeq ORF 450 bp
Locus ID 223970
UniProt ID Q3UPE3
Cytogenetics 16 A1
MW 15.8 kDa
Summary Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates. It is required to regulate sister chromatid segregation and to limit DNA crossover. Essential for the stability, localization, and function of BLM, TOP3A, and complexes containing BLM. In the RMI complex, it is required to target BLM to chromatin and stress-induced nuclear foci and mitotic phosphorylation of BLM.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_001162932" in other vectors (4)
SKU Description Size Price
MC212718 Rmi2 (untagged) - Mouse RIKEN cDNA A630055G03 gene (A630055G03Rik), (10ug) 10 ug
$165.00
MG216967 Rmi2 (tGFP-tagged) - Mouse RIKEN cDNA A630055G03 gene (A630055G03Rik), (10ug) 10 ug
$350.00
MR216967L3 Lenti ORF clone of Rmi2 (Myc-DDK-tagged) - Mouse RIKEN cDNA A630055G03 gene (A630055G03Rik) 10 ug
$450.00
MR216967L4 Lenti ORF clone of Rmi2 (mGFP-tagged) - Mouse RIKEN cDNA A630055G03 gene (A630055G03Rik) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products