Acsl3 (NM_028817) Mouse Tagged ORF Clone

CAT#: MR216519

Reviews ()
Write a review
  • TrueORF®

Acsl3 (Myc-DDK-tagged) - Mouse acyl-CoA synthetase long-chain family member 3 (Acsl3), transcript variant 1



  "NM_028817" in other vectors (5)

Interest in protein/lysate? Submit request here!

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Acsl3
Synonyms 2610510B12Rik; Acs3; C85929; Facl3; Pro2194
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR216519 representing NM_028817
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATAACCACGTATCTTCAACACCATCAACCATGAAGCTAAAACAAACCATCAACCCCATACTTTTAT
ATTTCATACATTTTATAATATCACTCTATACTATTTTAACATACATCCCATTTTATTTTTTGTGTGAGTC
AAAACAAGAGAAACCAAACCAAATTAAAGCAAAACCTGTCAGTTCCAAACCGGACTCTGCATACAGATCT
ATCAACAGTGTGGATGGCTTGGCTTCAGTGCTGTATCCTGGCTGCGATACACTTGATAAAGTCTTTATGT
ATGCAAAAAACAAATTTAAAAACAAAAGACTATTGGGAACACGTGAAATTTTAAATGAGGAAGATGAAAT
ACAGCCAAATGGAAAAATTTTTAAAAAGGTTATTCTGGGGCACTATAATTGGCTTTCCTATGAAGATGTC
TTCATCCGAGCCCTTGACTTTGGAAATGGGTTACAAATGTTGGGCCAGAAACCAAAGGCCAACATCGCCA
TCTTCTGTGAGACCAGGGCTGAGTGGATGATCGCTGCACAGGCGTGTTTTATGTATAACTTCCAGCTTGT
TACACTGTATGCTACTCTGGGAGGTCCAGCCATTGTTCATGGACTGAATGAGACAGAGGTGACCAACATC
ATTACTAGCAAAGAACTCTTGCAAACAAAGCTGAAGGATATAGTCTCTTTGGTCCCACGTCTGCGGCATA
TCATTACTGTTGATGGGAAGCCTCCAACCTGGTCTGAGTTCCCCAAAGGTGTCATTGTACACACCATGGC
TGCAGTGCAGGCTCTAGGAGTGAAGGCCAACGTGGAAAAGAAAGCTCACAGCAAACCACTGCCCTCAGAT
ATTGCAGTAATCATGTACACAAGTGGGTCCACAGGAATTCCAAAGGGAGTCATGATCTCACACAGCAACA
TCATTGCTTCTATAACGGGGATGGCGAGAAGGATTCCAAGACTGGGAGAGGAAGATGTGTATATTGGCTA
CTTGCCCCTGGCACATGTTCTAGAATTAAGTGCTGAGCTTGTGTGTCTTTCTCATGGATGCCGAATCGGC
TACTCTTCACCACAGACATTAGCAGATCAGTCTTCAAAAATAAAAAAAGGAAGCAAAGGAGACACATCCG
TGCTGAAGCCAACACTGATGGCAGCTGTTCCGGAAATCATGGATCGGATCTACAAAAATGTCATGAATAA
AGTGAATGAAATGAGTGCTTTTCAACGAAACTTGTTTATTTTGGCATATAATTATAAGATGGAACAGATT
TCAAAAGGGTGTAGTACTCCACTGTGTGACCGCTTTGTTTTCCGGAATGTCCGAAGGCTGCTGGGTGGAA
ATATTCGCCTTTTACTGTGTGGTGGTGCTCCGCTTTCTGCAACAACGCAGCGATTCATGAATATCTGTTT
CTGCTGTCCCGTTGGTCAGGGGTATGGACTCACAGAATCTACTGGGGCTGGAACAATTACAGAAGTGTGG
GACTACAATACCGGCAGAGTGGGAGCACCATTAGTTTGCTGTGAAATCAAATTAAAGAACTGGGAGGAAG
GTGGCTATTTTAATACTGACAAACCACATCCCAGAGGTGAAATTCTTATTGGTGGCCAAAATGTGACAAT
GGGGTACTACAAAAATGAAGCAAAAACAAAGACAGATTTCTTTGAAGATGAAAATGGACAGCGGTGGCTG
TGCACTGGAGATATTGGAGAGTTTGACCCTGACGGCTGTCTGAAGATCATTGACCGTAAAAAGGACCTTG
TGAAACTACAGGCAGGAGAGTACGTTTCTCTCGGGAAAGTAGAGGCAGCTTTGAAGAACCTCCCACTGAT
AGATAACATTTGTGCGTATGCAAACAGCTACCATTCTTACGTAATTGGGTTTGTTGTGCCAAATCAAAAG
GAACTTACAGAGCTAGCTAGAACAAAAGGATTTAAAGGAACTTGGGAAGAGCTGTGTAACAGCAGCGAGA
TGGAAAATGAGGTCCTTAAAGTGCTTTCTGAAGCTGCTATTTCAGCAAGTCTGGAAAAGTTTGAAATTCC
ACTAAAAATACGTTTGAGCCCTGACCCATGGACTCCCGAAACTGGTCTGGTGACAGATGCCTTCAAGTTG
AAACGTAAAGAGCTTAAAACACACTACCAGGCAGACATTGAGCGGATGTATGGAAGAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR216519 representing NM_028817
Red=Cloning site Green=Tags(s)

MNNHVSSTPSTMKLKQTINPILLYFIHFIISLYTILTYIPFYFLCESKQEKPNQIKAKPVSSKPDSAYRS
INSVDGLASVLYPGCDTLDKVFMYAKNKFKNKRLLGTREILNEEDEIQPNGKIFKKVILGHYNWLSYEDV
FIRALDFGNGLQMLGQKPKANIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHGLNETEVTNI
ITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGVIVHTMAAVQALGVKANVEKKAHSKPLPSD
IAVIMYTSGSTGIPKGVMISHSNIIASITGMARRIPRLGEEDVYIGYLPLAHVLELSAELVCLSHGCRIG
YSSPQTLADQSSKIKKGSKGDTSVLKPTLMAAVPEIMDRIYKNVMNKVNEMSAFQRNLFILAYNYKMEQI
SKGCSTPLCDRFVFRNVRRLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESTGAGTITEVW
DYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQNVTMGYYKNEAKTKTDFFEDENGQRWL
CTGDIGEFDPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLIDNICAYANSYHSYVIGFVVPNQK
ELTELARTKGFKGTWEELCNSSEMENEVLKVLSEAAISASLEKFEIPLKIRLSPDPWTPETGLVTDAFKL
KRKELKTHYQADIERMYGRK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_028817
ORF Size 2160 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_028817.3, NP_083093.2
RefSeq Size 3950 bp
RefSeq ORF 2163 bp
Locus ID 74205
UniProt ID Q9CZW4
Cytogenetics 1 40.84 cM
MW 80.9 kDa
Gene Summary Acyl-CoA synthetases (ACSL) activates long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL3 has mainly an anabolic role in energy metabolism (By similarity). Required for the incorporation of fatty acids into phosphatidylcholine, the major phospholipid located on the surface of VLDL (very low density lipoproteins) (By similarity). Mediates hepatic lipogenesis (By similarity). Preferentially uses myristate, laurate, arachidonate and eicosapentaenoate as substrates (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "Acsl3"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.