Adam11 (NM_009613) Mouse Tagged ORF Clone

CAT#: MR216099

Reviews ()
Write a review
  • TrueORF®

Adam11 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 11 (Adam11), transcript variant 2



  "NM_009613" in other vectors (4)

Interest in protein/lysate? Submit request here!

USD 610.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Adam11 (NM_009613) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Adam11
Synonyms AW060611; Mdc
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR216099 representing NM_009613
Red=Cloning site Blue=ORF Green=Tags(s)

CTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCCGGCGC
GCC
C

ATGAGGCGGCTGCGGCGCTGGGCGATCGCGGCTCTGCTGCTGTTACCGCTTCTCCCCCCGCCCGGTCTTG
GGGCCCTGGGTCCCAGAGGAGCTCTGCACTGGAGGAGCTCAGCCCATGTGGGGAGCCCAGAGAGTCCAGA
GGGCTCTGAGGTCACAGAGCCCAGCCGGCTGGTAAGGCAGAGCTCCGGGGGAGAGGTCCGAAAGCCACAG
TTGGACACCAGGGTCCGCCAGGATCCGCCCAGGGGGACGCCTGTGCACCTGGCCCAGGTGAGTTTCGTCA
TCCCGGCCTTCGACTCAAACTTCACTCTGGACCTGGAGCTGAACCATCACCTCCTGTCCTCGCAGTATGT
GGAGCGCCACTTCAGCCGGGAGGGAACAAGACAACACAGCACTGGGGCTGGAGACCACTGCTACTACCAT
GGGAAACTCCGGGGCAACCCACAGTCCTTTGCTGCACTCTCTACATGCCAGGGGCTGCATGGGGTCTTCT
CTGATGGCAACCTGACTTACATCGTAGAGCCTAAGGAGATAGCTGGGCCCTGGGGACCCCCACAGGGACC
CCTTCCCCACCTCATTTACCGGACCCCTCTCCTCCCAGCCCCCCTTGGATGCAGGGAGCCAGGCTGCCTG
TTTGCTGTCCCTGCCCAGTCTGCTCTCCCCAACTGGCCCAAGCTAAGAAGGAAAAGGCAGGTCCGCAGGG
GCCACCCCACAGTGCACAGCGAGACCAAGTATGTGGAGTTGATTGTAATCAATGACCACCAGCTGTTTGA
GCAGATGCGGCAGTCAGTGGTCCTCACCAGCAACTTTGCAAAATCTGTTGTGAACCTGGCAGATGTGATA
TACAAGGAACAGCTCAACACAAGAATTGTTCTGGTTGCCATGGAAACGTGGGCAGATGGGGACAAGATCC
AGGTGCAGGATGACCTACTGGAGACCCTGGCCCGGCTTATGGTCTACCGGCGGGAGGGTCTGCCTGAGCC
CAGTGATGCCACCCACCTCTTCTCGGGTAGAACCTTCCAGAGCACCAGCAGCGGGGCGGCCTACGTGGGA
GGCATCTGTTCACTGTCCCGGGGTGGAGGTGTGAACGAGTATGGCAACATGGGTGCCATGGCGGTGACCC
TGGCCCAGACGCTAGGGCAGAACTTGGGCATGATGTGGAATAAGCACCGGAGCTCAGCAGGGGACTGCAA
GTGTCCAGACATTTGGCTGGGCTGCATCATGGAGGACACTGGGTTCTATTTGCCCCGCAAGTTCTCGCGC
TGCAGCATCGACGAATACAACCAGTTTCTGCAGGAGGGAGGCGGGAGCTGCCTGTTCAACAAGCCCCTCA
AGCTTCTGGACCCTCCCGAGTGCGGAAACGGCTTCGTGGAGGCGGGAGAGGAGTGCGACTGCGGGTCGGT
GCAGGAGTGCAGCCGAGCAGGGGGCAACTGCTGCAAAAAATGCACCTTGACGCACGACGCCATGTGCAGC
GATGGGCTCTGTTGTCGCCGCTGCAAGTATGAGCCACGAGGTGTCTCCTGCCGAGAAGCGGTGAATGAGT
GTGACATTGCAGAGACCTGCACCGGCGACTCAAGCCAGTGTCCCCCTAACCTTCACAAGCTGGACGGTTA
CTACTGTGATCATGAGCAGGGTCGTTGCTATGGAGGCCGCTGTAAAACCCGGGACCGGCAGTGCCAAGCC
CTATGGGGCCATGCGGCTGCGGATCGTTTCTGCTATGAGAAGCTGAACGTGGAGGGGACAGAGCGTGGAA
ACTGTGGACGCAAGGGATCTGGTTGGGTCCAGTGCAGTAAGCAGGATGTGCTCTGTGGCTTCCTTCTGTG
CGTCAACATCTCTGGAGCTCCGCGGCTAGGGGATCTGGGGGGCGACATCAGCAGTGTCACCTTCTACCAC
CAGGGCAAGGAGTTGGACTGCAGGGGAGGCCACGTGCAGCTAGCTGATGGCTCGGACCTGAGCTATGTGG
AGGACGGCACGGCCTGTGGGCCCAACATGTTGTGCCTAGATCACCGCTGCCTGCCAGCCTCTGCCTTCAA
CTTCAGCACCTGCCCTGGAAGTGGAGAGCGAAGGATCTGCTCCCATCATGGGGTTTGCAGCAACGAGGGG
AAGTGTATCTGTCAGCCAGACTGGACAGGCAAAGACTGCAGTATTCACAACCCACTGCCCACGTCCCCTC
CCACTGGGGAGACTGAGAGATACAAAGGTCCCAGCGGTACCAACATCATCATTGGCTCCATCGCCGGGGC
TGTCCTGGTCGCAGCCATCGTCCTGGGCGGCACGGGCTGGGGATTTAAAAACATCCGTCGTGGAAGGTCC
GGAGGGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR216099 representing NM_009613
Red=Cloning site Green=Tags(s)

MRRLRRWAIAALLLLPLLPPPGLGALGPRGALHWRSSAHVGSPESPEGSEVTEPSRLVRQSSGGEVRKPQ
LDTRVRQDPPRGTPVHLAQVSFVIPAFDSNFTLDLELNHHLLSSQYVERHFSREGTRQHSTGAGDHCYYH
GKLRGNPQSFAALSTCQGLHGVFSDGNLTYIVEPKEIAGPWGPPQGPLPHLIYRTPLLPAPLGCREPGCL
FAVPAQSALPNWPKLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVI
YKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVG
GICSLSRGGGVNEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSR
CSIDEYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLTHDAMCS
DGLCCRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQGRCYGGRCKTRDRQCQA
LWGHAAADRFCYEKLNVEGTERGNCGRKGSGWVQCSKQDVLCGFLLCVNISGAPRLGDLGGDISSVTFYH
QGKELDCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPASAFNFSTCPGSGERRICSHHGVCSNEG
KCICQPDWTGKDCSIHNPLPTSPPTGETERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRS
GGA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites AscI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_009613
ORF Size 2319 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_009613.1, NM_009613.2, NM_009613.3, NP_033743.2
RefSeq Size 4647 bp
RefSeq ORF 2322 bp
Locus ID 11488
Cytogenetics 11 66.48 cM
MW 84.6 kDa
Gene Summary This gene encodes a member of a disintegrin and metalloprotease (ADAM) family of endoproteases that play important roles in various biological processes including cell signaling, adhesion and migration. The encoded preproprotein undergoes proteolytic processing to generate a mature, functional protein. The protein encoded by this gene is believed to lack metalloproteinase activity due to the lack of a critical catalytic motif. Mice lacking the encoded protein exhibit defects in spatial learning, motor coordination and altered perception of pain. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing. [provided by RefSeq, May 2016]

Citations (1)

Other Versions

Other products for "Adam11"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools