Fabp6 (NM_008375) Mouse Tagged ORF Clone
CAT#: MR215685
- TrueORF®
Fabp6 (Myc-DDK-tagged) - Mouse fatty acid binding protein 6, ileal (gastrotropin) (Fabp6)
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_008375" in other vectors (4)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Fabp6 |
Synonyms | GT; I; I-1; I-15P; I-B; I-BABP; IL; ILBP; ILBP3; Illbp |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR215685 representing NM_008375
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCTTCAGTGGCAAATATGAATTTGAGAGTGAGAAGAATTACGATGAGTTCATGAAGCGCCTGGGTC TTCCAGGAGACGTGATTGAAAGGGGACGTAACTTCAAGATCATCACAGAGGTCCAGCAGGACGGACAGGA CTTCACCTGGTCCCAGTCTTACTCTGGGGGCAACATTATGAGCAACAAGTTCACCATTGGCAAAGAATGT GAAATGCAGACCATGGGGGGCAAGAAGTTCAAGGCTACCGTGAAGATGGAGGGTGGCAAGGTGGTGGCAG AGTTCCCCAACTATCACCAGACTTCGGAGGTCGTGGGTGACAAGTTGGTGGAGATCTCCACCATCGGGGA TGTGACCTATGAGCGCGTAAGCAAGAGGCTGGCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR215685 representing NM_008375
Red=Cloning site Green=Tags(s) MAFSGKYEFESEKNYDEFMKRLGLPGDVIERGRNFKIITEVQQDGQDFTWSQSYSGGNIMSNKFTIGKEC EMQTMGGKKFKATVKMEGGKVVAEFPNYHQTSEVVGDKLVEISTIGDVTYERVSKRLA myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_008375 |
ORF Size | 384 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_008375.2, NP_032401.1 |
RefSeq Size | 387 bp |
RefSeq ORF | 387 bp |
Locus ID | 16204 |
UniProt ID | P51162 |
Cytogenetics | 11 25.81 cM |
MW | 14.9 kDa |
Gene Summary | The protein encoded by this gene is part of the fatty acid binding protein family (FABP). FABPs are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands and participate in fatty acid uptake, transport, and metabolism. This protein functions within the ileum, the distal 25-30% of the small intestine, and plays a role in enterohepatic circulation of bile acids and cholesterol homeostasis. In humans, it has been reported that polymorphisms in FABP6 confer a protective effect in obese individuals from developing type 2 diabetes. In mice deficiency of this gene affects bile acid metabolism in a gender-specific manner and was reported to be required for efficient apical to basolateral transport of conjugated bile acids. [provided by RefSeq, Jan 2013] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC208789 | Fabp6 (untagged) - Mouse fatty acid binding protein 6, ileal (gastrotropin) (Fabp6), (10ug) |
USD 165.00 |
|
MG215685 | Fabp6 (tGFP-tagged) - Mouse fatty acid binding protein 6 ileal (gastrotropin) (Fabp6), (10ug) |
USD 350.00 |
|
MR215685L3 | Lenti ORF clone of Fabp6 (Myc-DDK-tagged) - Mouse fatty acid binding protein 6, ileal (gastrotropin) (Fabp6) |
USD 450.00 |
|
MR215685L4 | Lenti ORF clone of Fabp6 (mGFP-tagged) - Mouse fatty acid binding protein 6, ileal (gastrotropin) (Fabp6) |
USD 450.00 |
{0} Product Review(s)
Be the first one to submit a review