Sirt4 (NM_001167691) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MR215307
Sirt4 (Myc-DDK-tagged) - Mouse sirtuin 4 (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) (Sirt4), transcript variant 1
$289.00 $300.00
In Stock*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Sirt4
Synonyms 4930596O17Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR215307 representing NM_001167691
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGGATTGACTTTCAGGCCGACAAAGGGCCGTTGGATCACCCACCTCAGCCGGCCGCGTTCTTGTG
GACCCTCGGGGTTATTTGTGCCGCCCAGCCCTCCTTTGGACCCTGAAAAGATCAAAGAGTTACAGCGCTT
CATTAGCCTTTCCAAGAAACTCCTCGTGATGACAGGCGCGGGGATCTCCACCGAGTCCGGCATCCCAGAC
TACAGGTCAGAAAAGGTGGGACTTTACGCCCGCACTGACCGGAGACCCATCCAGCACATTGATTTCGTCC
GCAGTGCTCCGGTCCGCCAGCGGTACTGGGCCCGAAACTTTGTGGGCTGGCCTCAATTCTCCTCTCACCA
ACCCAACCCAGCACACTGGGCTCTGAGCAACTGGGAGAGACTGGGGAAGCTGCACTGGTTGGTGACTCAG
AACGTGGACGCTTTGCACTCCAAAGCAGGGAGTCAGCGGCTGACGGAGCTCCACGGATGCATGCACAGAG
TCCTGTGCCTGAACTGTGGGGAGCAGACTGCCCGCAGGGTGCTGCAGGAACGCTTCCAAGCCCTGAACCC
CAGCTGGAGCGCCGAGGCGCAGGGCGTGGCTCCCGACGGCGACGTGTTCCTCACTGAGGAGCAGGTCCGG
AGCTTTCAGGTCCCGTGCTGTGATCGATGCGGCGGCCCTCTGAAACCGGACGTCGTTTTCTTTGGGGACA
CGGTGAACCCAGACAAGGTTGACTTTGTGCACCGGCGTGTGAAAGAGGCGGACTCCCTACTGGTGGTGGG
ATCATCCCTGCAGGTGTACTCTGGTTACAGGTTCATCCTCACCGCCCGCGAGCAAAAGCTCCCAATAGCC
ATTCTGAATATCGGCCCCACCCGGTCTGACGATTTGGCTTGCCTGAAGCTGGATTCCCGCTGTGGAGAGT
TGCTGCCTTTAATAGACCCGCGGAGACAGCACTCTGATGTCCAAAGGCTGGAAATGAACTTTCCTCTGAG
TTCCGCTGCTCAAGATCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR215307 representing NM_001167691
Red=Cloning site Green=Tags(s)

MSGLTFRPTKGRWITHLSRPRSCGPSGLFVPPSPPLDPEKIKELQRFISLSKKLLVMTGAGISTESGIPD
YRSEKVGLYARTDRRPIQHIDFVRSAPVRQRYWARNFVGWPQFSSHQPNPAHWALSNWERLGKLHWLVTQ
NVDALHSKAGSQRLTELHGCMHRVLCLNCGEQTARRVLQERFQALNPSWSAEAQGVAPDGDVFLTEEQVR
SFQVPCCDRCGGPLKPDVVFFGDTVNPDKVDFVHRRVKEADSLLVVGSSLQVYSGYRFILTAREQKLPIA
ILNIGPTRSDDLACLKLDSRCGELLPLIDPRRQHSDVQRLEMNFPLSSAAQDP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001167691
ORF Size 999 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001167691.1, NP_001161163.1
RefSeq Size 1645 bp
RefSeq ORF 1002 bp
Locus ID 75387
UniProt ID Q8R216
Cytogenetics 5 F
MW 38 kDa
Summary Acts as NAD-dependent protein lipoamidase, ADP-ribosyl transferase and deacetylase (PubMed:19220062). Catalyzes more efficiently removal of lipoyl- and biotinyl- than acetyl-lysine modifications. Inhibits the pyruvate dehydrogenase complex (PDH) activity via the enzymatic hydrolysis of the lipoamide cofactor from the E2 component, DLAT, in a phosphorylation-independent manner (PubMed:25525879). Catalyzes the transfer of ADP-ribosyl groups onto target proteins, including mitochondrial GLUD1, inhibiting GLUD1 enzyme activity. Acts as a negative regulator of mitochondrial glutamine metabolism by mediating mono ADP-ribosylation of GLUD1: expressed in response to DNA damage and negatively regulates anaplerosis by inhibiting GLUD1, leading to block metabolism of glutamine into tricarboxylic acid cycle and promoting cell cycle arrest (PubMed:16959573). In response to mTORC1 signal, SIRT4 expression is repressed, promoting anaplerosis and cell proliferation (PubMed:23663782). Acts as a tumor suppressor (PubMed:23562301, PubMed:23663782). Also acts as a NAD-dependent protein deacetylase: mediates deacetylation of 'Lys-471' of MLYCD, inhibiting its activity, thereby acting as a regulator of lipid homeostasis (PubMed:23746352). Does not seem to deacetylate PC (PubMed:23438705). Controls fatty acid oxidation by inhibiting PPARA transcriptional activation. Impairs SIRT1:PPARA interaction probably through the regulation of NAD(+) levels (PubMed:24043310, PubMed:20685656). Down-regulates insulin secretion (By similarity).UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_001167691" in other vectors (4)
SKU Description Size Price
MC211618 Sirt4 (untagged) - Mouse sirtuin 4 (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) (Sirt4), transcript variant 1, (10ug) 10 ug
$457.00
MG215307 Sirt4 (tGFP-tagged) - Mouse sirtuin 4 (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) (Sirt4) transcript variant 1, (10ug) 10 ug
$500.00
MR215307L3 Lenti ORF clone of Sirt4 (Myc-DDK-tagged) - Mouse sirtuin 4 (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) (Sirt4), transcript variant 1 10 ug
$600.00
MR215307L4 Lenti ORF clone of Sirt4 (mGFP-tagged) - Mouse sirtuin 4 (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) (Sirt4), transcript variant 1 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products