Treml4 (NM_001033922) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MR215269
Treml4 (Myc-DDK-tagged) - Mouse triggering receptor expressed on myeloid cells-like 4 (Treml4), transcript variant 1
  $480.00
2 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Treml4
Synonyms 5031403H21Rik; BB137214; IDCP1; TLT-4; TLT4; Treml3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR215269 representing NM_001033922
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTGGAGGTACTCACAACTGCTCCTGGTCCCTGTGCAGCTGGTGTTCCTGGCCTCAGGTGTCTGGG
GGTCCACAGTATCTGAAGAGCTTCATAGAATGGTAGGACAGAGCCTCTCCGTGCAGTGCCAATACAAGCC
TAAGGAGGAGTCCTATGTGCTGAAAACGTGGTGTCGGCAAACAGCCCCAAGTAAATGTACGAGAGTGGTC
ACTACCTCTGAGCCTCGGAAAGCAGCCAGGGAATTACAGCACACAATCTGGGATGATCCTGAAGCTGGCT
TCTTCAACATCACCATGACTCAACTAACAGAGGATGACTCAGCGTTCTACTGGTGTGGTCCATATTATCC
TTCCCTCAGAGAAGTAACTGTTCTCAGAAACATCAGCCTGGTGGTGTCGCCAGCCCCATCAACCCTTCCT
TCGCAGACGATTGCTCCGCTCCCAGAAAGCACAGCCACCATCTTTATGCCCTTCCCAGTTCTGACTACCT
CTCCCGAGGAGACCACTGACTCTTCCATCAATGGCACTGGGCACAGAAACCAAAGTTCCTCCTCTCCTGG
CTGGACCTCCCCGGGGCTTCTGGTCTCTGTGCAATATGGACTCCTCCTGCTCAAGGCCCTGATGCTGTCA
GTTTTCTGTGTGCTTCTTTGCTGGAGGAGTGGCCAGGGACGAGAGTACATGGCAGAGACGATGGAGCTTT
CAAAACTACCTCACATCTCCAAGTCCTTGGACACGGTTAGCCACATCTCAGGGTATGAGAAGAAGGCTAA
CTGGTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR215269 representing NM_001033922
Red=Cloning site Green=Tags(s)

MAWRYSQLLLVPVQLVFLASGVWGSTVSEELHRMVGQSLSVQCQYKPKEESYVLKTWCRQTAPSKCTRVV
TTSEPRKAARELQHTIWDDPEAGFFNITMTQLTEDDSAFYWCGPYYPSLREVTVLRNISLVVSPAPSTLP
SQTIAPLPESTATIFMPFPVLTTSPEETTDSSINGTGHRNQSSSSPGWTSPGLLVSVQYGLLLLKALMLS
VFCVLLCWRSGQGREYMAETMELSKLPHISKSLDTVSHISGYEKKANWY

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001033922
ORF Size 777 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001033922.2, NP_001029094.1
RefSeq Size 1730 bp
RefSeq ORF 780 bp
Locus ID 224840
UniProt ID Q3LRV9
Cytogenetics 17 C
MW 29.4 kDa
Summary Positively regulates Toll-like receptor signaling via TLR7, TLR9 and TLR13 in neutrophils and splenic macrophages (PubMed:25848864). Regulates TLR7 signaling by controlling ligand-induced recruitment of TLR7 from the endoplasmic reticulum to endosomes and lysosomes (PubMed:25848864). Positively regulates Toll-like receptor TLR9-induced production of inflammatory cytokines but is dispensable for IFNB1 production (PubMed:25848864). Involved in the anti-viral response to several viruses including influenza virus, vesicular stomatitis virus and cytomegalovirus (PubMed:25848864). Binds to late apoptotic, and necrotic cells, but not living or early apoptotic cells, but is not essential for uptake of dying cells by dendritic cells (DCs) (PubMed:22210914, PubMed:19155473, PubMed:25848864). Does not bind nucleic acids (PubMed:25848864). May participate in antigen presentation (PubMed:22210914).UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_001033922" in other vectors (4)
SKU Description Size Price
MC212739 Treml4 (untagged) - Mouse triggering receptor expressed on myeloid cells-like 4 (Treml4), transcript variant 1, (10ug) 10 ug
$480.00
MG215269 Treml4 (tGFP-tagged) - Mouse triggering receptor expressed on myeloid cells-like 4 (Treml4) transcript variant 1, (10ug) 10 ug
$680.00
MR215269L3 Lenti ORF clone of Treml4 (Myc-DDK-tagged) - Mouse triggering receptor expressed on myeloid cells-like 4 (Treml4), transcript variant 1 10 ug
$780.00
MR215269L4 Lenti ORF clone of Treml4 (mGFP-tagged) - Mouse triggering receptor expressed on myeloid cells-like 4 (Treml4), transcript variant 1 10 ug
$780.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products