Bub1b (NM_009773) Mouse Tagged ORF Clone

CAT#: MR211540

Bub1b (Myc-DDK-tagged) - Mouse budding uninhibited by benzimidazoles 1 homolog, beta (S. cerevisiae) (Bub1b)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,339.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Bub1b (NM_009773) Mouse Tagged ORF Clone
Symbol Bub1b
Synonyms AU045529; BUBR1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR211540 representing NM_009773
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAGGCGAGTGAAGCCATGTGCCTGGAGGGAGCAGAGTGGGAGCTGAGTAAAGAAAACATACAGC
CCTTACGGCACGGGCGGGTCATGTCCACACTTCAGGGAGCTTTGGCAAAGCAAGAGTCAGCCGGCCACAC
TGCTCTGCAGCAGCAGAAACGGGCATTTGAATCTGAAATCCGCTTTTACTCTGGAGATGACCCTCTGGAT
GTGTGGGACAGATATATTAATTGGACAGAACAGAACTACCCTCAAGGGGGGAAAGAGAGTAACATGTCAG
CGTTAGTGGAGAGAGCGATAGAAGCACTCCAAGGAGAGACGCGCTATTATAATGACCCCCGCTTTCTCAG
TCTCTGGATCAAATTGGGACATTTGTGCAATGAACCTTTGGATATGTACAGCTATTTACAAAGCCAAGGA
ATTGGCGTTTCCCTTGCCCAGTTCTATATTTCATGGGCTGAAGAATACGAAGCTAGAGAAAATTTCAAGA
AAGCGGACATAATATTCCAGGAAGGGATTGAACGCAAGGCTGAGCCCCTGGACAGACTGCAGTCCCAGCA
CAGACAGTTCCAGTCTCGAGTGTCGCGACAAGCTTTCTTGGCCCTTGGGAATGAAGAGGAGGAGGCTTTG
GAGCCTTCTGAACCACAGAGAAGCTCGCTAGCTGAGCTGAAGAGCAGAGGGAAGAAGATGGCCAGAGCGC
CCATCAGCCGTGTCGGAGGTGCTCTGAAAGCTCCAGGTCAGAGCAGAGGGTTCCTAAATGCAGTTCCCCA
GCCAGTACACGGTAATCGCAGGATCACCGTTTTTGATGAAAATGCCGATACCGCGTCTAGAACGGAGTTA
TCTAAGCCTGTAGCCCAGCCATGGATGGCACCCCCTGTGCCCAGGGCCAAAGAGAACGAACTTCAGCCAG
GCCCATGGAGCACAGACAGGCCGGCGGGACGCAGGCCTCATGACAATCCAGCCTCTGTGACGTCGATTCC
CAGCGTGCTTCCCAGCTTTACGCCGTACGTGGAAGAGAGCGCCCAGCAGACAGTCATGACACCATGCAAG
ATTGAGCCTAGTATCAACCATGTTCTCAGCACCAGGAAGCCAGGGAGAGAAGAAGGAGACCCCTTGCAGA
GAGTTCAGAGTCATCAGCAAGGCTGTGAGGAGAAGAAGGAGAAGATGATGTACTGTAAGGAGAAGATCTA
TGCCGGAGTTGGGGAGTTCTCCTTTGAGGAGATCCGAGCTGAAGTGTTCCGAAAGAAGCTGAAAGAACGA
AGGGAAGCCGAGCTGTTGACCAGTGCAAAGAAGAGGGAGGAGATGCAGAAGCAGATCGAAGAGATGGAGA
GGAGGCTGAAGGCAATGCAGGCTGTTCAGCAAGAAGGAGCTGGGGGCCAGCAAGAAGAGAAGATGCCTAC
AGAGGACCCAGCCAGATTGCAGATTGCTTCGGGGCCTCAGGAAATGTCGGGAGTTCCTCTGTCCTGTTCC
ATCTGTCCACTAAGCTCGAATCCTAGGGAAATTTCACCTGCTGAGAACATTTTGCAAGAACAGCCTGATT
CTAAAGGTTCCAGTATGCCTTTCTCCATTTTTGATGAGTCTCTTTCAGACAAAAAGGACAAAAGTCCTGC
TACAGGTGGTCCACAGGTTCTCAATGCCCAGAGAAGACCCCTTTCAGTTCTCAAAACTACAGAAGTGGGC
ACCACAAATGAGGATGTGTCTCCCGATATTTGTGATGAACTCACAGAACTTGAGCCTCTGAGTGAAGACG
CCATCATCACTGGTTTCAGGAACGTCACTCTCTGTCCCAACCCTGAGGACACTTGTGACTTTGCTAGAGC
AGCTCGTTTGGCATCTACTCCTTTCCATGAGATACTGTCCTCGAAGGGCATCGCTGCTGATCCCGAGGGA
CTGTTGCAGGAAGAGGATCTGGATGGGAAGGCCGCCGAGGCTCATCACACTGTTCATCACCAGGCCCTCA
TCATAAAGAAACTGAGCCCAATTATTGAAGAGAGCCGTGAGGCCACCCACTCATCTGGCTTCTCCAGGTC
TTCTTCCTCAGCTCCCAGTACATCCTCCATCAAAGGCTTTCAGCTTCTGGAAAAGCTGGAGCTGACTAAT
GACGGGGCAGAAGATGCTATTCAGTCACCCTGGTGTTCACAGTATCGCCTACAACTGTTAAAATCCCTAC
TAGAATTAAGTGCTTTTGCGGAGTTTTCTGTGGAAGACCGACCGATGCCTGTGCTGGAAATAGGGAAGGA
GATTGAGTTAGGTCCTGAGGATTACGTCATCAAGCAAGAGCACCTAACATGTGACGATTACAGGTTATTC
TGGGTGGCACCAAGAAGCTCTGCAGAGCTAACCATGATAAAGGCATCATCTCAGCCTATCCCGTGGGATT
TTTATATCAACCTCAAGTTGAAGGAGCGTCTGAATGAGGACTATGACCAGCTTTGCAGCTGCTGTCAGTA
CCAAGATGGCCATGTTGTTTGGTACCAGTATATAAACTGCTCCACCCTTCAGAATCTTCTCCAACACAGC
GAATTTGTTACTCATGAAATAATAGTGTTGATTATTTACAACCTCTTGACAATCGTGGAGAAGCTACACA
GAGCTGAAATAGTACACGGAGACTTGAGTCCACGGAGTCTGATCCTACGAAACAGAATCCACGACCCCTA
TGACTATGTAAATAAGGACGATCACGCTGTGAGGATCATGGACTTCTCCTACAGTGTTGACCTGAGGGTG
CAGCTGGATGCGTTTGCCTATAGTGGCTTTCGGACTGCACAGATCCTGGAAGGACAAAAGATCCTGGCTA
ACTGTTCTTCTCCCTACCATGTAGATCTGTTGGGTATAGCAGACCTAGCGCACTTACTCCTGTTCAAGGA
GCACCTCCATGTCTTCTGGGATGGACTCCTCTGGAAACTTAGCCAGAGCACCTCTGAGCTAAAAGACAGT
GAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAGTGACAAGTCCACAGTGTCTGTTCTGGGGG
AGCTGGCAGCAGAAATGGGTGGGGCTTTTGATGCCACATTCCATAGCCACCTGAACAGAGCCCTGTGGAA
GCTGGGGAAGACAATCAGCCCGGAAGCTTTGCTCACTCAGCAAGACAAGCAGCCAGGCGGCTCCCAGAGC
CCTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR211540 representing NM_009773
Red=Cloning site Green=Tags(s)

MAEASEAMCLEGAEWELSKENIQPLRHGRVMSTLQGALAKQESAGHTALQQQKRAFESEIRFYSGDDPLD
VWDRYINWTEQNYPQGGKESNMSALVERAIEALQGETRYYNDPRFLSLWIKLGHLCNEPLDMYSYLQSQG
IGVSLAQFYISWAEEYEARENFKKADIIFQEGIERKAEPLDRLQSQHRQFQSRVSRQAFLALGNEEEEAL
EPSEPQRSSLAELKSRGKKMARAPISRVGGALKAPGQSRGFLNAVPQPVHGNRRITVFDENADTASRTEL
SKPVAQPWMAPPVPRAKENELQPGPWSTDRPAGRRPHDNPASVTSIPSVLPSFTPYVEESAQQTVMTPCK
IEPSINHVLSTRKPGREEGDPLQRVQSHQQGCEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKER
REAELLTSAKKREEMQKQIEEMERRLKAMQAVQQEGAGGQQEEKMPTEDPARLQIASGPQEMSGVPLSCS
ICPLSSNPREISPAENILQEQPDSKGSSMPFSIFDESLSDKKDKSPATGGPQVLNAQRRPLSVLKTTEVG
TTNEDVSPDICDELTELEPLSEDAIITGFRNVTLCPNPEDTCDFARAARLASTPFHEILSSKGIAADPEG
LLQEEDLDGKAAEAHHTVHHQALIIKKLSPIIEESREATHSSGFSRSSSSAPSTSSIKGFQLLEKLELTN
DGAEDAIQSPWCSQYRLQLLKSLLELSAFAEFSVEDRPMPVLEIGKEIELGPEDYVIKQEHLTCDDYRLF
WVAPRSSAELTMIKASSQPIPWDFYINLKLKERLNEDYDQLCSCCQYQDGHVVWYQYINCSTLQNLLQHS
EFVTHEIIVLIIYNLLTIVEKLHRAEIVHGDLSPRSLILRNRIHDPYDYVNKDDHAVRIMDFSYSVDLRV
QLDAFAYSGFRTAQILEGQKILANCSSPYHVDLLGIADLAHLLLFKEHLHVFWDGLLWKLSQSTSELKDS
ELWNKFFVRILNASDKSTVSVLGELAAEMGGAFDATFHSHLNRALWKLGKTISPEALLTQQDKQPGGSQS
PA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_009773
ORF Size 3156 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_009773.1, NM_009773.2, NM_009773.3, NP_033903
RefSeq Size 3669
RefSeq ORF 3159
Locus ID 12236
Cytogenetics 2|2 E5
MW 118.8 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations