Asap2 (NM_001098168) Mouse Tagged ORF Clone

CAT#: MR211308

Asap2 (Myc-DDK-tagged) - Mouse ArfGAP with SH3 domain, ankyrin repeat and PH domain 2 (Asap2), transcript variant 1

Change vector?

  • TrueORF®

USD 1,216


Availability*
6 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Asap2 (NM_001098168) Mouse Tagged ORF Clone
Symbol Asap2
Synonyms 6530401G17Rik; Ddef2; Gm1523; Gm592; PAG3; PAP
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR211308 representing NM_001098168
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGACCAGATCTCCGTGTCGGAATTCGTGGCCGAGACCCATGAGGACTACAAGGCGCCCACGGCCT
CTAGCTTCACCACGCGCACGGCCCAGTGCCGGAACACCGTGGCGGCCATCGAGGAGGCTTTGGACGTGGA
CCGGATGGTTCTCTACAAAATGAAGAAATCTGTGAAGGCAATCAATATCTCTGGGCTGGCACACGTGGAG
AACGAGGAACAGTACACCCAGGCTCTGGAGAAGTTCGGTGGCAACTGTGTGTGCAGAGATGATCCAGACT
TAGGAAGCGCGTTTCTGAAGTTCTCTGTGTTCACCAAGGAGTTGACGGCACTCTTCAAAAACCTGATTCA
GAACATGAACAACATCATCTCGTTCCCTTTGGACAGTTTGCTGAAAGGAGATCTGAAAGGAGTAAAAGGG
GATCTGAAAAAGCCCTTTGATAAAGCTTGGAAGGACTATGAAACAAAAATAACCAAAATAGAAAAGGAGA
AAAAGGAGCATGCCAAGCTCCACGGGATGATTCGTACTGAAATAAGCGGGGCTGAGATTGCAGAGGAGAT
GGAGAAGGAAAGACGGTTCTTCCAGCTGCAGATGTGTGAGTACCTGCTGAAGGTCAATGAAATCAAGGTG
AAAAAGGGAGTGGATTTGCTTCAGAATCTGATCAAGTACTTTCACGCCCAGTGCAATTTTTTCCAGGATG
GATTGAAAGCAGTAGAAAGCCTCAAGCCTTCCATCGAGACGCTCTCCACGGACCTCCACACCATCAAACA
GGCCCAGGATGAGGAACGGCGACAGCTGATACAACTTCGAGATATTTTGAAGTCAGCATTGCAGGTGGAA
CAGAAAGAGTCTAGGAGAGACTCACAACTTCGCCAAAGTACAGCCTACAGCTTACATCAACCTCAGGGAA
ACAAGGAGCATGGAACAGAGAGGAACGGGAACCTCTACAAGAAGAGCGATGGGATCCGGAAAGTGTGGCA
GAAGAGGAAGTGTTCCGTTAAAAATGGCTTCCTCACCATCTCCCACGGCACTGCCAACCGGCCACCTGCC
AAGCTCAACCTGCTAACCTGCCAGGTGAAGACCAATCCTGAGGAGAAGAAGTGTTTCGACCTCATATCAC
ATGACAGGACGTACCACTTCCAAGCGGAAGACGAACAAGAATGTCAGATATGGATGTCTGTACTGCAGAA
CAGCAAGGAAGAAGCTCTGAACAACGCCTTTAAGGGTGATGACAACACTGGAGAAAATAACATCGTCCAA
GAGCTGACCAAGGAGATCATCTCGGAGGTGCAGAGGATGACGGGCAATGACGTGTGCTGCGACTGTGGGG
CACCAGATCCGACGTGGCTCTCTACCAACCTGGGCATCCTGACTTGCATCGAGTGCTCTGGGATCCACCG
GGAGCTGGGGGTTCATTACTCCAGGATGCAGTCCCTGACATTAGATGTATTGGGAACGTCTGAGCTTCTG
CTTGCCAAGAATATCGGGAATGCAGGCTTTAATGAAATTATGGAGTGTTGCCTACCGTCTGAGGACCCAG
TCAAGCCCAACCCAGGCAGTGACATGATTGCAAGGAAGGACTACATCACAGCCAAGTACATGGAGAGGAG
ATATGCACGGAAAAAGCATGCCGACACCGCGGCGAAGCTCCACAGCCTTTGCGAGGCCGTCAAGACCAGA
GACATTTTTGGGTTACTCCAAGCTTATGCTGATGGTGTGGACCTGACAGAGAAAATCCCACTGGCCAATG
GGCATGAGCCAGATGAGACAGCCCTCCATCTTGCAGTCAGATCTGTGGACCGGACTTCCCTTCACATTGT
AGACTTCCTGGTCCAGAACAGTGGGAACCTGGATAAACAGACAGGCAAGGGCAGCACAGCCCTGCACTAC
TGCTGCCTGACAGACAATGCTGAGTGCCTCAAGCTCCTCCTGCGGGGAAAAGCCTCCATTGAGATAGCCA
ATGAGTCAGGAGAGACCCCGTTGGACATTGCTAAGCGGCTCAAGCACGAACACTGTGAGGAACTGCTCAC
TCAGGCCTTGTCGGGGCGGTTTAACTCCCATGTTCACGTCGAGTATGAATGGCGGCTGCTGCACGAGGAC
CTGGATGAGAGCGACGACGATGTGGACGAGAAGCTACAGCCTAGTCCCAACCGACGGGAGGACCGGCCTG
TTAGCTTCTACCAGCTGGGGTCCAGCCAGTTTCAGTCCAATGCTGTGTCTTTGGCCAGAGATACTGCAAA
CCTCACCAAGGACAAGCAGAGGGGCTTTGGGCCCAGCATCTTGCAGAATGAGACCTATGGAGCCATCCTG
AGTGGCAGCCCGCCCTCCTCCCAGTCAATACCCCCCAGCACCACCAGCGCACCCCCGCTCCCACCTCGGA
ATGTTGGCAAAGATCCCCTGACCACCACACCACCCCCTCCTGTGGCTAAGACATCAGGAACTCTAGAAGC
CATGAACCAGCCGAGCAAGTCCTCCCAACCTGGGACCTCACAGAGCAAGCCCCCGCCCCTGCCACCTCAG
CCACCCAGCCGCCTGCCTCAGAAGAAACCAGCTTCCGGGACTGACAAGCCAACCCCGCTGACCAACAAAG
GACAGCCGAGAGGACCTGAAGCTTCGGGTCCTCTGTCCAACGCCATGGCCCTGCAGCCCCCAGCACCCAT
GCCTAGGAAGTCACAGGCGACCAAGTCAAAGCCCAAGCGAGTGAAAGCACTCTACAACTGCGTGGCTGAC
AACCCAGACGAGCTGACTTTCTCTGAGGGCGACGTGATCATTGTGGATGGGGAAGAGGATCAGGAGTGGT
GGATCGGCCACATCGATGGAGAGCCCAGCCGCAAAGGAGCGTTTCCCGTATCGTTTGTGCACTTTATTGC
TGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR211308 representing NM_001098168
Red=Cloning site Green=Tags(s)

MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKAINISGLAHVE
NEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMNNIISFPLDSLLKGDLKGVKG
DLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISGAEIAEEMEKERRFFQLQMCEYLLKVNEIKV
KKGVDLLQNLIKYFHAQCNFFQDGLKAVESLKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVE
QKESRRDSQLRQSTAYSLHQPQGNKEHGTERNGNLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPA
KLNLLTCQVKTNPEEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQ
ELTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSELL
LAKNIGNAGFNEIMECCLPSEDPVKPNPGSDMIARKDYITAKYMERRYARKKHADTAAKLHSLCEAVKTR
DIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTSLHIVDFLVQNSGNLDKQTGKGSTALHY
CCLTDNAECLKLLLRGKASIEIANESGETPLDIAKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHED
LDESDDDVDEKLQPSPNRREDRPVSFYQLGSSQFQSNAVSLARDTANLTKDKQRGFGPSILQNETYGAIL
SGSPPSSQSIPPSTTSAPPLPPRNVGKDPLTTTPPPPVAKTSGTLEAMNQPSKSSQPGTSQSKPPPLPPQ
PPSRLPQKKPASGTDKPTPLTNKGQPRGPEASGPLSNAMALQPPAPMPRKSQATKSKPKRVKALYNCVAD
NPDELTFSEGDVIIVDGEEDQEWWIGHIDGEPSRKGAFPVSFVHFIAD

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001098168
ORF Size 2874 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001098168.1, NP_001091637
RefSeq Size 5566
RefSeq ORF 2877
Locus ID 211914
Cytogenetics 12|12 A1.2-A1.3
MW 107.3 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations