Appl1 (NM_145221) Mouse Tagged ORF Clone

CAT#: MR210175

  • TrueORF®

Appl1 (Myc-DDK-tagged) - Mouse adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 (Appl1)

 Cited in 1 publication.

  View "NM_145221" in other vectors (10)

USD 68.00

USD 509.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Appl1 (NM_145221) Mouse Tagged ORF Clone
Symbol Appl1
Synonyms 2900057D21Rik; 7330406P05Rik; AI585782; AW209077; BB022931; C88264; DIP13
Vector pCMV6-Entry
Sequence Data
>MR210175 representing NM_145221
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGGGATCGACAAGCTGCCCATTGAAGAGACCCTGGAGGACAGTCCGCAGACAAGGTCTTTACTTG
GTGTATTTGAAGAAGATGCTACTGCTATTTCAAATTATATGAACCAATTGTATCAAGCTATGCATCGGAT
TTATGATGCACAGAATGAATTGAGTGCAGCAACACACCTGACTTCGAAACTTTTGAAAGAATATGAAAAA
CAGCGTTTTCCTTTGGGGGGTGATGATGAAGTTATGAGCTCTACTTTGCAGCAGTTTTCCAAGGTCATAG
ATGAGCTTAGTTCTTGTCATGCAGTACTTTCAACTCAACTTGCTGATGCCATGATGTTCCCCATTTCCCA
GTTTAAAGAAAGAGATCTGAAAGAAATATTGACACTAAAGGAGGTATTTCAAATTGCTAGTAATGATCAT
GATGCCGCAATTAATAGGTACAGTCGGTTGTCAAAAAAGAGAGAAAATGACAAGGTAAAATATGAAGTTA
CAGAGGATGTATATACTTCCAGGAAAAAACAACACCAGACCATGATGCATTATTTTTGTGCACTAAATAC
TCTTCAGTACAAGAAGAAAATAGCTTTGTTAGAACCTCTACTGGGATACATGCAGGCTCAGATAAGTTTC
TTTAAGATGGGTTCTGAAAATCTCAATGGACAACTGGAAGAATTCTTAGCTAACATTGGAACAAGTGTAC
AGAATGTTCGAAGAGAAATGGATGGTGATGTAGAGACCATGCAGCAGACAATAGAAGACTTGGAGGTAGC
CAGTGACCCTTTATATCTGCCTGACCCGGATCCCACCAAGTTTCCCATCAATCGAAATTTAACCCGAAAG
GCTGGATACCTAAATGCTAGGAATAAAACAGGCTTGGTGTCATCTACCTGGGATAGACAGTTTTACTTCA
CGCAGGGTGGAAACTTAATGAGTCAAGCCCGTGGAGATGTGGCAGGAGGCCTAGCCATGGACATAGACAA
CTGTTCAGTGATGGCTGTGGACTGTGAAGACAGACGATACTGTTTTCAGATCACTTCTTTTGATGGAAAA
AAATCTTCAATATTGCAAGCAGAGAGTAAAAAAGACCATGAAGAGTGGATCTGTACAATAAACAACATAT
CTAAACAAATATATTTGAGTGAAAATCCAGAGGAAACTGCTGCACGAGTGAATCAGTCTGCTCTAGAAGC
TGTCACTCCTTCCCCATCTTTCCAGCAGAGACACGAGAGCCTGCGTCCAGGAGGACAATCTCGGCCACCA
ACAGCTCGAACCAGCAGTTCAGGATCCTTGGGATCAGAGTCTACAAATTTGGCTGCCCTCTCTCTAGATT
CTCTTGTTGCTCCGGATACACCAATACAGTTTGATATAATTTCTCCTGTGTGTGAAGATCAGCCTGGCCA
GGCAAAAGCCTTTGGTCAAGGAGGCAGGCGTACAAATCCATTTGGAGAATCTGGAGGAAGCACAAAATCA
GAAACAGAAGACTCTATTCTTCATCAGTTATTTATTGTCCGATTCCTTGGTTCTATGGAGGTAAAGTCAG
ATGACCATCCAGATGTTGTCTATGAAACAATGCGCCAGATCTTAGCTGCTCGGGCCATCCACAACATCTT
TCGTATGACAGAATCACATTTATTAGTCACTTGTGACTGCTTGAAGTTAATTGATCCGCAGACCCAAGTT
ACAAGGCTCACATTTCCATTGCCGTGTGTAGTTCTGTATGCTACGCACCAGGAAAATAAACGACTTTTTG
GATTTGTTCTCCGGACATCAGGCGGAAGAAGTGAGAGTAATTTGTCATCAGTCTGCTATATATTTGAATC
AAACAATGAGGGAGAAAAGATTTGTGATTCTGTTGGACTGGCAAAACAGATAGCTTTGCATGCTGAACTG
GATCGTAGGGCATCAGAAAAACAAAAAGAAATAGAGAGAGTAAAAGAGAAACAGCAGAAAGAGCTCAGCA
AACAGAAACAGATTGAGAAGGACTTGGAAGAACAGAGTCGGTTGATAGCTGCCTCCAGTAGACCAAACCA
GGCTGGTAGTGAGGGCCAGCTTGTTCTTAGCAGTAGCCAATCAGAGGAGAGTGATTTGGGAGAAGAAGGG
AAAAAAAGAGAGTCGGAAGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR210175 representing NM_145221
Red=Cloning site Green=Tags(s)

MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEK
QRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPISQFKERDLKEILTLKEVFQIASNDH
DAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISF
FKMGSENLNGQLEEFLANIGTSVQNVRREMDGDVETMQQTIEDLEVASDPLYLPDPDPTKFPINRNLTRK
AGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGK
KSSILQAESKKDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPGGQSRPP
TARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNPFGESGGSTKS
ETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQV
TRLTFPLPCVVLYATHQENKRLFGFVLRTSGGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAEL
DRRASEKQKEIERVKEKQQKELSKQKQIEKDLEEQSRLIAASSRPNQAGSEGQLVLSSSQSEESDLGEEG
KKRESEA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_145221
ORF Size 2121 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_145221.1, NM_145221.2, NP_660256
RefSeq Size 6961
RefSeq ORF 2124
Locus ID 72993
Cytogenetics 14|14 A3
MW 79.8 kDa

Citations (1)

Other Versions

Other products for "Appl1"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Order online and get additional $20 off!
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies