Appl1 (NM_145221) Mouse Tagged ORF Clone

CAT#: MR210175

Reviews ()
Write a review
  • TrueORF®

Appl1 (Myc-DDK-tagged) - Mouse adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 (Appl1)



  "NM_145221" in other vectors (4)

Interest in protein/lysate? Submit request here!

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Appl1
Synonyms 2900057D21Rik; 7330406P05Rik; AI585782; AW209077; BB022931; C88264; DIP13
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR210175 representing NM_145221
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGGGATCGACAAGCTGCCCATTGAAGAGACCCTGGAGGACAGTCCGCAGACAAGGTCTTTACTTG
GTGTATTTGAAGAAGATGCTACTGCTATTTCAAATTATATGAACCAATTGTATCAAGCTATGCATCGGAT
TTATGATGCACAGAATGAATTGAGTGCAGCAACACACCTGACTTCGAAACTTTTGAAAGAATATGAAAAA
CAGCGTTTTCCTTTGGGGGGTGATGATGAAGTTATGAGCTCTACTTTGCAGCAGTTTTCCAAGGTCATAG
ATGAGCTTAGTTCTTGTCATGCAGTACTTTCAACTCAACTTGCTGATGCCATGATGTTCCCCATTTCCCA
GTTTAAAGAAAGAGATCTGAAAGAAATATTGACACTAAAGGAGGTATTTCAAATTGCTAGTAATGATCAT
GATGCCGCAATTAATAGGTACAGTCGGTTGTCAAAAAAGAGAGAAAATGACAAGGTAAAATATGAAGTTA
CAGAGGATGTATATACTTCCAGGAAAAAACAACACCAGACCATGATGCATTATTTTTGTGCACTAAATAC
TCTTCAGTACAAGAAGAAAATAGCTTTGTTAGAACCTCTACTGGGATACATGCAGGCTCAGATAAGTTTC
TTTAAGATGGGTTCTGAAAATCTCAATGGACAACTGGAAGAATTCTTAGCTAACATTGGAACAAGTGTAC
AGAATGTTCGAAGAGAAATGGATGGTGATGTAGAGACCATGCAGCAGACAATAGAAGACTTGGAGGTAGC
CAGTGACCCTTTATATCTGCCTGACCCGGATCCCACCAAGTTTCCCATCAATCGAAATTTAACCCGAAAG
GCTGGATACCTAAATGCTAGGAATAAAACAGGCTTGGTGTCATCTACCTGGGATAGACAGTTTTACTTCA
CGCAGGGTGGAAACTTAATGAGTCAAGCCCGTGGAGATGTGGCAGGAGGCCTAGCCATGGACATAGACAA
CTGTTCAGTGATGGCTGTGGACTGTGAAGACAGACGATACTGTTTTCAGATCACTTCTTTTGATGGAAAA
AAATCTTCAATATTGCAAGCAGAGAGTAAAAAAGACCATGAAGAGTGGATCTGTACAATAAACAACATAT
CTAAACAAATATATTTGAGTGAAAATCCAGAGGAAACTGCTGCACGAGTGAATCAGTCTGCTCTAGAAGC
TGTCACTCCTTCCCCATCTTTCCAGCAGAGACACGAGAGCCTGCGTCCAGGAGGACAATCTCGGCCACCA
ACAGCTCGAACCAGCAGTTCAGGATCCTTGGGATCAGAGTCTACAAATTTGGCTGCCCTCTCTCTAGATT
CTCTTGTTGCTCCGGATACACCAATACAGTTTGATATAATTTCTCCTGTGTGTGAAGATCAGCCTGGCCA
GGCAAAAGCCTTTGGTCAAGGAGGCAGGCGTACAAATCCATTTGGAGAATCTGGAGGAAGCACAAAATCA
GAAACAGAAGACTCTATTCTTCATCAGTTATTTATTGTCCGATTCCTTGGTTCTATGGAGGTAAAGTCAG
ATGACCATCCAGATGTTGTCTATGAAACAATGCGCCAGATCTTAGCTGCTCGGGCCATCCACAACATCTT
TCGTATGACAGAATCACATTTATTAGTCACTTGTGACTGCTTGAAGTTAATTGATCCGCAGACCCAAGTT
ACAAGGCTCACATTTCCATTGCCGTGTGTAGTTCTGTATGCTACGCACCAGGAAAATAAACGACTTTTTG
GATTTGTTCTCCGGACATCAGGCGGAAGAAGTGAGAGTAATTTGTCATCAGTCTGCTATATATTTGAATC
AAACAATGAGGGAGAAAAGATTTGTGATTCTGTTGGACTGGCAAAACAGATAGCTTTGCATGCTGAACTG
GATCGTAGGGCATCAGAAAAACAAAAAGAAATAGAGAGAGTAAAAGAGAAACAGCAGAAAGAGCTCAGCA
AACAGAAACAGATTGAGAAGGACTTGGAAGAACAGAGTCGGTTGATAGCTGCCTCCAGTAGACCAAACCA
GGCTGGTAGTGAGGGCCAGCTTGTTCTTAGCAGTAGCCAATCAGAGGAGAGTGATTTGGGAGAAGAAGGG
AAAAAAAGAGAGTCGGAAGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR210175 representing NM_145221
Red=Cloning site Green=Tags(s)

MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEK
QRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPISQFKERDLKEILTLKEVFQIASNDH
DAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISF
FKMGSENLNGQLEEFLANIGTSVQNVRREMDGDVETMQQTIEDLEVASDPLYLPDPDPTKFPINRNLTRK
AGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGK
KSSILQAESKKDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPGGQSRPP
TARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNPFGESGGSTKS
ETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQV
TRLTFPLPCVVLYATHQENKRLFGFVLRTSGGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAEL
DRRASEKQKEIERVKEKQQKELSKQKQIEKDLEEQSRLIAASSRPNQAGSEGQLVLSSSQSEESDLGEEG
KKRESEA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_145221
ORF Size 2121 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_145221.2, NP_660256.1
RefSeq Size 6961 bp
RefSeq ORF 2124 bp
Locus ID 72993
UniProt ID Q8K3H0
Cytogenetics 14 A3
MW 79.8 kDa
Gene Summary Multifunctional adapter protein that binds to various membrane receptors, nuclear factors and signaling proteins to regulate many processes, such as cell proliferation, immune response, endosomal trafficking and cell metabolism (By similarity) (PubMed:25328665, PubMed:25568335, PubMed:27219021). Regulates signaling pathway leading to cell proliferation through interaction with RAB5A and subunits of the NuRD/MeCP1 complex (By similarity). Functions as a positive regulator of innate immune response via activation of AKT1 signaling pathway by forming a complex with APPL1 and PIK3R1 (PubMed:25328665). Inhibits Fc-gamma receptor-mediated phagocytosis through PI3K/Akt signaling in macrophages (PubMed:25568335). Regulates TLR4 signaling in activated macrophages (PubMed:27219021). Involved in trafficking of the TGFBR1 from the endosomes to the nucleus via microtubules in a TRAF6-dependent manner. Plays a role in cell metabolism by regulating adiponecting and insulin signaling pathways (By similarity). Required for fibroblast migration through HGF cell signaling (PubMed:26445298). Positive regulator of beta-catenin/TCF-dependent transcription through direct interaction with RUVBL2/reptin resulting in the relief of RUVBL2-mediated repression of beta-catenin/TCF target genes by modulating the interactions within the beta-catenin-reptin-HDAC complex (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "Appl1"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.