Atg7 (NM_028835) Mouse Tagged ORF Clone

CAT#: MR210108

Atg7 (Myc-DDK-tagged) - Mouse autophagy-related 7 (yeast) (Atg7)

Change vector?

  • TrueORF®

USD 98

USD 870


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Atg7 (NM_028835) Mouse Tagged ORF Clone
Symbol Atg7
Synonyms 1810013K23Rik; Agp7; Apg7l; Atg7l; Gm21553
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR210108 representing NM_028835
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGACCCTGGACTGGCCAAGTTGCAGTTCGCCCCCTTTAATAGTGCCCTGGACGTTGGCTTCTGGC
ACGAACTGACCCAGAAGAAGTTGAACGAGTACCGCCTGGACGAGGCACCCAAAGACATCAAGGGCTATTA
CTACAATGGTGACTCTGCTGGTCTGCCCACCCGCTTGACGTTGGAGTTCAGTGCTTTTGACATGAGTGCC
TCCACGCCTGCCCACTGCTGCCCGGCCATGGGAACCCTGCACAACACCAACACACTTGAGGCTTTTAAGA
CAGCAGACAAGAAGCTCCTTCTGGAGCAGTCAGCAAATGAGATCTGGGAAGCCATAAAGTCAGGTGCTGC
TCTCGAAAACCCCATGCTCCTCAACAAGTTTCTGCTCCTGACCTTCGCGGACCTAAAGAAGTACCACTTC
TACTACTGGTTTTGCTGCCCCGCCCTCTGTCTTCCTGAGAGCATCCCTCTAATCCGGGGACCTGTGAGCT
TGGATCAAAGGCTTTCACCAAAACAGATCCAGGCCCTGGAGCATGCCTATGATGATCTGTGTCGAGCCGA
AGGCGTCACGGCCCTGCCCTACTTCTTATTCAAGTACGATGACGACACTGTTCTGGTCTCCTTGCTCAAA
CACTACAGTGATTTCTTCCAAGGTCAAAGGACAAAGATAACAGTTGGTGTGTACGATCCCTGTAACCTAG
CCCAGTACCCTGGATGGCCTTTGAGGAATTTTTTGGTCCTGGCAGCCCACAGATGGAGCGGCAGTTTCCA
GTCCGTTGAAGTCCTCTGCTTTCGGGACCGCACCATGCAGGGAGCTAGAGACGTGACACATAGCATCATC
TTTGAAGTGAAACTTCCAGAAATGGCATTTAGCCCAGATTGTCCTAAAGCTGTTGGCTGGGAGAAGAACC
AGAAAGGAGGCATGGGTCCGAGGATGGTGAACCTCAGTGGATGTATGGACCCCAAAAGGCTGGCTGAGTC
ATCTGTGGATCTGAATCTCAAGCTGATGTGCTGGCGATTGGTCCCCACCTTGGACTTGGACAAGGTCGTG
TCTGTCAAGTGCCTGCTGCTGGGAGCTGGTACCTTGGGGTGTAATGTGGCTAGGACACTGATGGGCTGGG
GCGTCAGACATGTCACCTTTGTGGATAACGCCAAGATCTCCTACTCCAATCCCGTGAGGCAGCCTCTGTA
TGAATTTGAAGATTGTCTAGGGGGTGGCAAGCCCAAGGCCCTGGCTGCAGCAGAGCGGCTACAGAAAATA
TTTCCCGGAGTGAATGCCAGAGGGTTCAACATGAGCATCCCCATGCCAGGACACCCTGTGAACTTCTCTG
ACGTCACGATGGAGCAGGCCCGCAGAGATGTGGAGCAGCTGGAGCAGCTCATTGATAACCATGATGTCAT
CTTCCTGCTAATGGACACCAGGGAGAGCCGGTGGCTTCCTACTGTTATTGCAGCCAGCAAGCGAAAGCTG
GTCATCAACGCTGCCTTGGGGTTTGATACCTTTGTTGTCATGAGACATGGCCTGAAGAAACCCAAGCAGC
AGGGAGCCGGAGACCTCTGCCCAAGCCATCTTGTAGCACCTGCTGACCTGGGCTCCTCACTTTTTGCCAA
CATCCCTGGATACAAGCTTGGCTGCTACTTCTGCAATGATGTGGTGGCTCCAGGAGATTCAACCAGAGAC
CGGACTCTGGACCAGCAGTGCACAGTGAGCCGCCCAGGCCTGGCCGTGATTGCAGGTGCCCTGGCTGTGG
AGCTGATGGTCTCTGTCCTGCAGCATCCTGAGGGGGGCTACGCCATCGCCAGCAGCAGTGATGACCGCAT
GAATGAGCCTCCCACCTCGCTGGGACTTGTGCCTCACCAGATCCGGGGTTTTCTGTCACGGTTCGATAAT
GTTCTTCCTGTCAGCCTGGCATTTGATAAATGTACAGCCTGTTCACCCAAAGTTCTTGATCAGTACGAGC
GAGAAGGATTCACCTTCCTAGCGAAGGTTTTTAACTCCTCACATTCCTTCTTAGAAGACTTGACCGGTCT
TACCCTGCTCCATCAAGAGACCCAAGCTGCTGAGATCTGGGACATGAGTGACGAGGAGACTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR210108 representing NM_028835
Red=Cloning site Green=Tags(s)

MGDPGLAKLQFAPFNSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPTRLTLEFSAFDMSA
STPAHCCPAMGTLHNTNTLEAFKTADKKLLLEQSANEIWEAIKSGAALENPMLLNKFLLLTFADLKKYHF
YYWFCCPALCLPESIPLIRGPVSLDQRLSPKQIQALEHAYDDLCRAEGVTALPYFLFKYDDDTVLVSLLK
HYSDFFQGQRTKITVGVYDPCNLAQYPGWPLRNFLVLAAHRWSGSFQSVEVLCFRDRTMQGARDVTHSII
FEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSGCMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVV
SVKCLLLGAGTLGCNVARTLMGWGVRHVTFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAAERLQKI
FPGVNARGFNMSIPMPGHPVNFSDVTMEQARRDVEQLEQLIDNHDVIFLLMDTRESRWLPTVIAASKRKL
VINAALGFDTFVVMRHGLKKPKQQGAGDLCPSHLVAPADLGSSLFANIPGYKLGCYFCNDVVAPGDSTRD
RTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDN
VLPVSLAFDKCTACSPKVLDQYEREGFTFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDEETV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_028835
ORF Size 2094 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_028835.1, NM_028835.2, NM_028835.3, NM_028835.4, NP_083111
RefSeq Size 3061
RefSeq ORF 2097
Locus ID 74244
Cytogenetics 6|6 E3
MW 78 kDa
Gene Summary This gene encodes an E1-like activating enzyme that is essential for autophagy and cytoplasmic to vacuole transport. The encoded protein is also thought to modulate p53-dependent cell cycle pathways during prolonged metabolic stress. It has been associated with multiple functions, including axon membrane trafficking, axonal homeostasis, mitophagy, adipose differentiation, and hematopoietic stem cell maintenance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations