App (NM_007471) Mouse Tagged ORF Clone

CAT#: MR210090

Reviews ()
Write a review
  • TrueORF®

App (Myc-DDK-tagged) - Mouse amyloid beta (A4) precursor protein (App), transcript variant 2



  "NM_007471" in other vectors (4)

Interest in protein/lysate? Submit request here!

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol App
Synonyms Abeta; Abpp; Adap; Ag; betaApp; Cvap; E030013M08Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR210090 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCCCAGCTTGGCACTGCTCCTGCTGGCCGCCTGGACGGTTCGGGCTCTGGAGGTACCCACTGATG
GCAACGCCGGGCTGCTGGCAGAACCCCAGATCGCCATGTTCTGTGGTAAACTCAACATGCACATGAATGT
GCAGAATGGAAAGTGGGAGTCAGACCCGTCAGGGACCAAAACCTGCATTGGCACCAAGGAGGGCATCTTG
CAGTACTGCCAAGAGGTCTACCCTGAACTGCAGATCACAAACGTGGTGGAAGCCAACCAGCCAGTGACCA
TCCAGAACTGGTGCAAGCGGGGCCGCAAGCAGTGCAAGACACACACCCACATCGTGATTCCTTACCGTTG
CCTAGTTGGTGAGTTTGTGAGCGACGCCCTTCTCGTGCCCGACAAGTGCAAGTTCCTACACCAGGAGCGG
ATGGATGTTTGTGAGACCCATCTTCACTGGCACACCGTCGCCAAAGAGACATGCAGCGAGAAGAGCACTA
ACTTGCACGACTATGGCATGCTGCTGCCCTGCGGCATCGACAAGTTCCGAGGGGTAGAGTTTGTATGCTG
CCCGTTGGCCGAGGAAAGCGACAGCGTGGATTCTGCGGATGCAGAGGAGGATGACTCTGATGTCTGGTGG
GGTGGAGCGGACACAGACTACGCTGATGGCGGTGAAGACAAAGTAGTAGAAGTCGCCGAAGAGGAGGAAG
TGGCTGATGTTGAGGAAGAGGAAGCTGATGATGATGAGGATGTGGAGGATGGGGACGAGGTGGAGGAGGA
GGCCGAGGAGCCCTACGAAGAGGCCACCGAGAGAACAACCAGCACTGCCACCACCACCACAACCACCACT
GAGTCCGTGGAGGAGGTGGTCCGAGTTCCCACGACAGCAGCCAGCACCCCCGACGCCGTCGACAAGTACC
TGGAGACACCCGGGGACGAGAACGAGCATGCCCATTTCCAGAAAGCCAAAGAGAGGCTGGAAGCCAAGCA
CCGAGAGAGAATGTCCCAGGTCATGAGAGAATGGGAAGAGGCAGAGCGTCAAGCCAAGAACTTGCCCAAA
GCTGACAAGAAGGCCGTTATCCAGCATTTCCAGGAGAAAGTGGAATCTCTGGAACAGGAAGCAGCCAATG
AGAGACAGCAGCTTGTAGAGACACACATGGCCAGAGTTGAAGCCATGCTCAATGACCGCCGCCGCCTGGC
CCTCGAGAATTACATCACTGCACTGCAGGCGGTGCCCCCAAGGCCTCATCATGTGTTCAACATGCTGAAG
AAGTACGTCCGTGCGGAGCAGAAAGACAGACAGCACACCCTAAAGCATTTTGAACATGTGCGCATGGTGG
ACCCCAAGAAAGCTGCTCAGATCCGGTCCCAGGTTATGACACACCTCCGTGTGATCTACGAGCGCATGAA
CCAGTCTCTGTCCCTGCTCTACAATGTCCCTGCGGTGGCTGAGGAGATTCAAGATGAAGTCGATGAGCTG
CTTCAGAAGGAGCAGAACTACTCCGACGATGTCTTGGCCAACATGATCAGTGAGCCCAGAATCAGCTACG
GAAACGACGCTCTCATGCCTTCGCTGACGGAAACCAAGACCACCGTGGAGCTCCTTCCCGTGAATGGGGA
ATTCAGCCTGGATGACCTCCAGCCGTGGCACCCTTTTGGGGTGGACTCTGTGCCAGCCAATACCGAAAAT
GAAGTCGAGCCTGTTGACGCCCGCCCCGCTGCTGACCGAGGACTGACCACTCGACCAGGTTCTGGGCTGA
CAAACATCAAGACGGAAGAGATCTCGGAAGTGAAGATGGATGCAGAATTCGGACATGATTCAGGATTTGA
AGTCCGCCATCAAAAACTGGTGTTCTTTGCTGAAGATGTGGGTTCGAACAAAGGCGCCATCATCGGACTC
ATGGTGGGCGGCGTTGTCATAGCAACCGTGATTGTCATCACCCTGGTGATGTTGAAGAAGAAACAGTACA
CATCCATCCATCATGGCGTGGTGGAGGTCGACGCCGCCGTGACCCCAGAGGAGCGCCATCTCTCCAAGAT
GCAGCAGAACGGATATGAGAATCCAACTTACAAGTTCTTTGAGCAAATGCAGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR210090 protein sequence
Red=Cloning site Green=Tags(s)

MLPSLALLLLAAWTVRALEVPTDGNAGLLAEPQIAMFCGKLNMHMNVQNGKWESDPSGTKTCIGTKEGIL
QYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQER
MDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDSVDSADAEEDDSDVWW
GGADTDYADGGEDKVVEVAEEEEVADVEEEEADDDEDVEDGDEVEEEAEEPYEEATERTTSTATTTTTTT
ESVEEVVRVPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPK
ADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPHHVFNMLK
KYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDEL
LQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHPFGVDSVPANTEN
EVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGL
MVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007471
ORF Size 2088 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007471.3
RefSeq Size 3152 bp
RefSeq ORF 2088 bp
Locus ID 11820
Cytogenetics 16 46.92 cM
MW 78.4 kDa
Gene Summary Functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. Interaction between APP molecules on neighboring cells promotes synaptogenesis. Involved in cell mobility and transcription regulation through protein-protein interactions. Can promote transcription activation through binding to APBB1-KAT5 and inhibit Notch signaling through interaction with Numb. Couples to apoptosis-inducing pathways such as those mediated by G(O) and JIP. Inhibits G(o) alpha ATPase activity (By similarity). Acts as a kinesin I membrane receptor, mediating the axonal transport of beta-secretase and presenilin 1. May be involved in copper homeostasis/oxidative stress through copper ion reduction. Can regulate neurite outgrowth through binding to components of the extracellular matrix such as heparin and collagen I and IV (By similarity). The splice isoforms that contain the BPTI domain possess protease inhibitor activity. Induces a AGER-dependent pathway that involves activation of p38 MAPK, resulting in internalization of amyloid-beta peptide and leading to mitochondrial dysfunction in cultured cortical neurons (By similarity). Provides Cu(2+) ions for GPC1 which are required for release of nitric oxide (NO) and subsequent degradation of the heparan sulfate chains on GPC1.[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


App Antibody - C-terminal region
    • 100 ul

USD 475.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.