Hspa5 (NM_001163434) Mouse Tagged ORF Clone

CAT#: MR209794

Hspa5 (Myc-DDK-tagged) - Mouse heat shock protein 5 (Hspa5), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 409.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Hspa5 (NM_001163434) Mouse Tagged ORF Clone
Symbol Hspa5
Synonyms AL022860; AU019543; baffled; Bip; D2Wsu141e; D2Wsu17e; Grp78; Hsce70; mBiP; SEZ-7; Sez7
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR209794 representing NM_001163434
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGAAGTTCACTGTGGTGGCGGCGGCGTTGCTGCTGCTGGGCGCGGTGCGGGCCGAGGAGGAGGACA
AGAAGGAGGATGTGGGCACGGTGGTCGGCATCGACTTGGGGACCACCTATTCCTGCGTCGGTGTGTTCAA
GAACGGCCGCGTGGAGATCATAGCCAACGATCAGGGCAACCGCATCACGCCGTCGTATGTGGCCTTCACT
CCTGAAGGGGAGCGTCTGATTGGCGATGCGGCCAAGAACCAACTCACGTCCAACCCCGAGAACACGGTCT
TCGATGCCAAGCGCCTCATCGGACGCACTTGGAATGACCCTTCGGTGCAGCAGGACATCAAGTTCTTGCC
ATTCAAGGTGGTTGAAAAGAAAACTAAACCGTACATTCAAGTTGATATTGGAGGTGGGCAAACCAAGACA
TTTGCCCCAGAAGAAATTTCTGCCATGGTTCTCACTAAAATGAAGGAGACTGCTGAGGCGTATTTGGGAA
AGAAGGTTACCCATGCAGTTGTTACTGTACCAGCTTACTTCAATGATGCCCAGCGACAAGCAACCAAAGA
TGCTGGCACTATTGCTGGACTGAATGTCATGAGGATCATCAATGAGCCTACAGCAGCTGCTATTGCATAT
GGCCTGGATAAGAGAGAGGGAGAGAAGAACATCCTTGTGTTTGACCTGGGTGGCGGCACCTTCGATGTGT
CTCTTCTCACCATTGACAATGGTGTCTTTGAAGTGGTGGCCACTAATGGAGATACTCACCTGGGTGGGGA
AGACTTTGATCAGCGGGTCATGGAACACTTCATCAAGTTGTACAAAAAGAAAACTGGTAAAGATGTTAGG
AAAGACAACAGAGCTGTGCAGAAACTCCGGCGTGAGGTAGAAAAGGCTAAGAGAGCCTTGTCTTCTCAGC
ATCAAGCAAGGATTGAAATTGAGTCCTTCTTCGAAGGAGAAGACTTCTCAGAGACCCTTACTCGGGCCAA
ATTTGAAGAGCTGAACATGGACCTGTTCCGCTCTACCATGAAGCCTGTCCAGAAAGTGTTGGAAGACTCT
GATCTGAAGAAATCTGATATTGATGAAATTGTTCTGGTTGGTGGATCTACTCGAATTCCAAAGATTCAGC
AACTGGTGAAAGAGTTCTTCAATGGCAAGGAGCCATCCCGTGGCATAAACCCCGATGAGGCTGTAGCCTA
TGGTGCCGCTGTCCAGGCTGGTGTCCTCTCTGGTGATCAGGATACAGGTGATCTGGTACTGCTTGATGTT
TGTCCCCTTACACTTGGTATTGAAACTGTGGGAGGAGTCATGACAAAACTGATTCCAAGGAACACTGTGG
TACCCACCAAGAAGTCTCAGATCTTCTCCACGGCTTCCGATAATCAGCCAACTGTAACAATCAAGGTCTA
TGAAGGTGAACGACCCCTAACAAAAGACAATCATCTTCTGGGTACATTTGATCTGACTGGAATTCCTCCT
GCTCCCCGTGGAGTTCCCCAGATTGAAGTCACTTTTGAGATAGATGTTAATGGTATTCTCCGAGTGACAG
CTGAAGACAAAGGTACAGGAAACAAAAACAAAATCACAATTACCAATGACCAAAACCGCCTGACACCTGA
AGAAATTGAAAGGATGGTTAATGATGCTGAGAAGTTTGCTGAGGAAGACAAAAAGCTCAAAGAGCGCATT
GACACCAGGAATGAATTGGAAAGCTATGCTTATTCTCTCAAGAACCAGATTGGAGATAAAGAAAAGCTGG
GAGGTAAACTTTCTTCTGAAGATAAAGAAACCATGGAAAAAGCTGTAGAGGAAAAGATTGAATGGCTGGA
AAGCCACCAGGATGCGGACATTGAAGACTTTAAAGCCAAAAAGAAGGAACTAGAAGAAATTGTTCAGCCA
ATTATCAGCAAACTCTATGGAAGTGGAGGCCCTCCCCCAACTGGTGAAGAGGATACATCAGAAAAAGATG
AGTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR209794 representing NM_001163434
Red=Cloning site Green=Tags(s)

MMKFTVVAAALLLLGAVRAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFT
PEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKT
FAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAY
GLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVR
KDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDS
DLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDV
CPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPP
APRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERI
DTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQP
IISKLYGSGGPPPTGEEDTSEKDEL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001163434
ORF Size 1965 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001163434.1, NP_001156906
RefSeq Size 2534
RefSeq ORF 1968
Locus ID 14828
Cytogenetics 2 B|2 22.94 cM
MW 72.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)