Atp6v1a (NM_007508) Mouse Tagged ORF Clone

CAT#: MR209449

Atp6v1a (Myc-DDK-tagged) - Mouse ATPase, H+ transporting, lysosomal V1 subunit A (Atp6v1a)

Change vector?

  • TrueORF®

USD 98

USD 760


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Atp6v1a (NM_007508) Mouse Tagged ORF Clone
Symbol Atp6v1a
Synonyms AI647066; Atp6a1; Atp6a2; Atp6v1a1; VA68; VPP2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR209449 representing NM_007508
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTTCTCCAAGCTACCCAAAATCCGCGATGAGGATAAAGAAAGTACATTTGGTTATGTGCATGGAG
TCTCAGGGCCTGTGGTTACAGCCTGTGACATGGCGGGCGCTGCCATGTACGAGCTGGTGAGAGTGGGGCA
CAGCGAGCTGGTTGGAGAAATTATTCGATTGGAAGGTGACATGGCCACCATTCAGGTGTATGAAGAGACT
TCTGGTGTCTCTGTTGGAGACCCCGTACTCCGCACTGGTAAACCTCTCTCGGTCGAGCTGGGTCCCGGGA
TTATGGGAGCCATTTTTGATGGTATACAGAGACCTCTGTCGGATATCAGCAGTCAGACCCAAAGTATCTA
CATCCCCAGAGGAGTCAATGTGTCTGCTCTCAGCAGAGATATCAAATGGGAGTTTATACCCAGCAAAAAC
CTACGGGTTGGTAGTCATATCACTGGTGGAGACATTTATGGGATTGTCAATGAGAACTCCCTCATCAAAC
ACAAAATCATGTTGCCCCCACGTAACAGAGGAAGCGTGACTTACATCGCGCCGCCTGGGAATTATGATGC
GTCCGATGTCGTCCTGGAGCTTGAGTTTGAAGGTGTGAAGGAGAAGTTCAGCATGGTCCAAGTGTGGCCT
GTGCGGCAGGTGCGGCCTGTCACTGAGAAGCTGCCCGCCAATCACCCCTTGCTTACTGGCCAGAGAGTCC
TCGATGCCCTTTTCCCGTGTGTTCAGGGAGGAACTACTGCTATCCCAGGCGCCTTTGGCTGTGGAAAGAC
TGTGATTTCCCAGTCTCTATCCAAGTACTCCAACAGTGACGTCATCATCTATGTCGGCTGCGGTGAGAGA
GGCAACGAGATGTCAGAAGTTCTCCGCGACTTCCCTGAGCTCACCATGGAGGTTGATGGGAAAGTAGAGT
CCATCATGAAGAGGACAGCGCTGGTAGCCAACACCTCCAACATGCCTGTGGCTGCAAGAGAGGCCTCCAT
CTACACTGGAATTACACTATCAGAATATTTCCGTGACATGGGCTACCACGTCAGTATGATGGCGGACTCT
ACCTCTAGATGGGCTGAGGCCCTCAGAGAAATCTCTGGTCGCTTAGCTGAGATGCCTGCAGATAGTGGAT
ACCCTGCATACCTTGGTGCCCGGCTGGCTTCTTTCTATGAGCGAGCAGGCAGAGTGAAATGTCTTGGAAA
CCCTGAGAGAGAAGGGAGTGTCAGCATTGTAGGAGCAGTTTCTCCACCTGGTGGTGATTTTTCTGATCCA
GTCACTTCTGCAACTCTGGGTATTGTTCAGGTGTTCTGGGGCTTGGATAAGAAGTTAGCTCAGCGCAAGC
ACTTCCCCTCTGTCAACTGGCTCATCAGCTACAGCAAGTACATGCGTGCCCTGGACGAGTACTATGACAA
GCACTTCACGGAGTTTGTTCCTCTGAGGACCAAAGCTAAGGAGATCCTGCAGGAAGAAGAGGATCTGGCA
GAAATCGTGCAGCTCGTGGGAAAGGCCTCTTTAGCAGAGACGGATAAAATCACTCTGGAGGTAGCAAAAC
TTATTAAAGATGACTTCCTACAGCAAAATGGGTACACTCCTTATGACAGGTTCTGTCCATTCTACAAGAC
AGTGGGGATGCTGTCCAACATGATTTCATTCTATGACATGGCCCGCCGAGCTGTGGAGACCACTGCCCAG
AGTGACAATAAGATCACATGGTCCATTATCCGGGAGCACATGGGGGAGATTCTCTATAAACTCTCCTCCA
TGAAATTCAAGGATCCAGTGAAAGATGGCGAGGCAAAGATCAAGGCCGACTATGCACAGCTTCTTGAAGA
TATGCAGAATGCATTCCGTAGCCTTGAAGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR209449 representing NM_007508
Red=Cloning site Green=Tags(s)

MDFSKLPKIRDEDKESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEET
SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDIKWEFIPSKN
LRVGSHITGGDIYGIVNENSLIKHKIMLPPRNRGSVTYIAPPGNYDASDVVLELEFEGVKEKFSMVQVWP
VRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGER
GNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADS
TSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDP
VTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLA
EIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMISFYDMARRAVETTAQ
SDNKITWSIIREHMGEILYKLSSMKFKDPVKDGEAKIKADYAQLLEDMQNAFRSLED

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007508
ORF Size 1851 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007508.2, NM_007508.3, NM_007508.4, NM_007508.5, NP_031534
RefSeq Size 3947
RefSeq ORF 1854
Locus ID 11964
Cytogenetics 16|16 B4
MW 68.8 kDa
Gene Summary Catalytic subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations