Hdac9 (NM_024124) Mouse Tagged ORF Clone

CAT#: MR209176

Hdac9 (Myc-DDK-tagged) - Mouse histone deacetylase 9 (Hdac9)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 449.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Hdac9 (NM_024124) Mouse Tagged ORF Clone
Symbol Hdac9
Synonyms AV022454; D030072B18Rik; HD7B; HD9; Hdac7b; HDRP; Mitr; mKIAA0744
Vector pCMV6-Entry
Sequence Data
>MR209176 representing NM_024124
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACAGTATGATCAGCTCAGTGGACGTGAAATCAGAGGTTCCTATGGGCCTGGAGCCCATCTCACCTT
TAGACCTGAGGACAGATCTCAGGATGATGATGCCTGTGGTGGATCCTGTCGTCCGCGAGAAGCAACTGCA
GCAAGAGTTACTTCTTATTCAGCAGCAGCAGCAGATCCAGAAGCAGCTCCTCATAGCAGAGTTTCAGAAG
CAGCACGAGAATTTGACAAGGCAGCATCAAGCACAACTCCAGGAGCACATCAAGGAACTTCTAGCCATAA
AACAACAGCAAGAACTCCTAGAAAAGGAGCAGAAACTGGAGCAGCAGAGGCAAGAACAGGAAGTAGAGAG
GCATCGCAGAGAGCAGCAGCTTCCTCCTCTCAGAGGCAAAGATAGAGGACGAGAAAGGGCAGTGGCAAGC
ACAGAGGTTAAGCAGAAGCTTCAAGAATTCCTGTTGAGTAAATCAGCAACAAAAGACACTCCAACCAATG
GAAAGAATCATTCCGTGGGCCGCCATCCCAAGCTCTGGTACACGGCTGCCCACCACACATCACTGGATCA
AAGCTCTCCACCCCTCAGTGGAACGTCTCCATCCTACAAGTACACATTACCAGGAGCTCAAGATAGCAAG
GATGATTTCCCCTTGAGAAAAACTGCCTCAGAGCCCAACTTGAAGGTGCGGTCCAGGTTAAAACAGAAAG
TGGCAGAGAGGAGAAGCAGTCCCTTACTCAGGCGGAAGGATGGAAATCTTGTCACTTCATTCAAGAAGCG
AGTGTTTGAGGTGGCAGAATCCTCGGTCAGTAGCAGCTCTCCAGGGTCAGGTCCCAGTTCACCAAACAAT
GGCCCTGCTGGGAATGTGACCGAAAATGAGGCTTCAGCTCTGCCTCCCACGCCTCACCCCGAGCAACTGG
TTCCACAGCAGCGCATACTAATTCATGAAGATTCCATGAACCTGCTAAGTCTCTATACCTCCCCGTCCCT
GCCCAATATCACTCTGGGACTTCCAGCAGTGCCGTCCCCACTCAATGCTTCTAACTCACTCAAAGACAAA
CAGAAGTGCGAGACACAGATGCTCAGACAAGGTGTTCCTCTGCCCAGTCAGTATGGCAGTAGCATTGCAG
CGTCCTCCAGCCACGTTCATGTAGCAATGGAAGGAAAACCCACCAGCAGCCACCAGGCTCTCCTGCAGCA
CCTACTGCTGAAGGAACAAATGCGACAGCAAAAGCTTCTCGTGGCTGGTGGAGTTCCATTACACCCTCAG
TCTCCTTTGGCAACAAAAGAAAGAATTTCACCAGGCATTAGAGGTACCCACAAATTGCCCCGCCACCGAC
CCCTGAATCGAACCCAGTCTGCACCTTTGCCTCAGAGCACGCTGGCTCAGCTGGTCATTCAGCAGCAGCA
CCAGCAGTTCCTGGAGAAGCAGAAACAATACCAGCAGCAGATCCACATGAACAAACTGCTATCGAAATCT
ATTGAACAACTGAAGCAACCAGGCAGCCACCTTGAAGAAGCAGAGGAGGAGCTTCAGGGGGACCAATCCA
TGGAAGACAGAGCAGCCTCTAAGGACAACAGTGCTAGGAGTGACAGCAGTGCTTGTGTGGAGGACACGCT
GGGACAAGTTGGGGCTGTGAAGGTCAAGGAGGAACCCGTGGACAGCGATGAAGATGCTCAGATACAGGAA
ATGGAATGTGGGGAGCAGGCTGCTTTTATGCAACAGGTAATAGGCAAAGATTTAGCTCCAGGATTTGTAA
TTAAAGTCATTATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR209176 representing NM_024124
Red=Cloning site Green=Tags(s)

MHSMISSVDVKSEVPMGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQKQLLIAEFQK
QHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQEVERHRREQQLPPLRGKDRGRERAVAS
TEVKQKLQEFLLSKSATKDTPTNGKNHSVGRHPKLWYTAAHHTSLDQSSPPLSGTSPSYKYTLPGAQDSK
DDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGNLVTSFKKRVFEVAESSVSSSSPGSGPSSPNN
GPAGNVTENEASALPPTPHPEQLVPQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSPLNASNSLKDK
QKCETQMLRQGVPLPSQYGSSIAASSSHVHVAMEGKPTSSHQALLQHLLLKEQMRQQKLLVAGGVPLHPQ
SPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNKLLSKS
IEQLKQPGSHLEEAEEELQGDQSMEDRAASKDNSARSDSSACVEDTLGQVGAVKVKEEPVDSDEDAQIQE
MECGEQAAFMQQVIGKDLAPGFVIKVII

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_024124
ORF Size 1764 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_024124.1, NM_024124.2, NM_024124.3, NP_077038
RefSeq Size 4461
RefSeq ORF 1767
Locus ID 79221
Cytogenetics 12|12 A3
MW 66.1 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)