Cdc25b (NM_001111075) Mouse Tagged ORF Clone

CAT#: MR208736

Cdc25b (Myc-DDK-tagged) - Mouse cell division cycle 25 homolog B (S. pombe) (Cdc25b), transcript variant 2

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 389.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cdc25b (NM_001111075) Mouse Tagged ORF Clone
Symbol Cdc25b
Synonyms AI604853
Vector pCMV6-Entry
Sequence Data
>MR208736 representing NM_001111075
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGTACCCCTGCAGAAGTCTGCGCCGGGTTCAGCTCTCAGTCCTGCCCGCGTGCTGGGTGGCATTC
AGCGGCCGCGCCACCTCTCGGTCTTTGAGTTTGAGTCTGATGGCTTCCTGGGGTCTCCGGAGCCTACAGC
TTCCTCCTCTCCGGTTACCACTCTTACACAGACCATGCACAACCTCGCTGGGCTCGGCAGTGAGCCTCCA
AAAGCTCAAGTAGGAAGCCTGTCGTTCCAGAACAGGCTGGCAGACCTATCCCTGTCCAGGCGCACCTCTG
AGTGCTCCCTGTCATCTGAGTCCTCAGAATCTTCGGATGCAGGTCTGTGCATGGACTCCCCCAGCCCTGT
GGACCCGCAGATGGCAGAGCGCACGTTTGAACAGGCCATTCAGGCAGCCAGTCGGGTCATTCAAAATGAG
CAGTTTACCATAAAACGCTTCCGATCCTTACCAGTGAGGCTGCTGGAACACAGTCCGGTGCTGCAGAGCA
TCACCAACTCCCGAGCACTGGACAGCTGGAGGAAAACTGAAGCAGGCTACCGAGCCGCCGCCAATAGTCC
TGGGGAGGACAAAGAGAATGTGCGCTTCCAGAGACCAAGATGGAGGAGCTCCAGGGAGAGAAGGTGTCTT
ACCACTGAGTGGAAGATGGAAGTAGAGGAGCTGAGCCCGGTGGCACAGTCTTCTTCCTTGACTCCTGTCG
AAAGGGCTTCTGAAGAAGATGACGGATTTGTGGACATCCTGGAGAGTGATTTAAAGGATGACGAGAAGGT
CCCCGCGGGCATGGAGAACCTCATTAGTGCCCCACTGGTCAAAAAGCTGGATAAGGAAGAGGAACAGGAT
CTCATCATGTTCAGCAAGTGCCAGAGGCTCTTCCGCTCCCCATCCATGCCATGCAGTGTGATCCGACCCA
TCCTCAAGAGGCTAGAGCGGCCCCAGGACCGGGATGTGCCTGTCCAGAGCAAGCGCAGGAAAAGTGTGAC
ACCCCTGGAAGAGCAGCAGCTTGAAGAACCTAAGGCCCGTGTCTTTCGCTCAAAGTCGCTGTGTCATGAG
ATTGAGAACATCCTGGATAGTGACCACCGTGGACTGATCGGAGATTACTCTAAGGCCTTCCTCCTGCAGA
CCGTGGATGGCAAACACCAAGACCTTAAGTACATCTCACCAGAAACTATGGTGGCCCTGTTAACAGGCAA
GTTCAGCAACATCGTGGAGAAATTTGTCATTGTGGACTGCAGATACCCCTATGAGTATGAAGGCGGGCAT
ATCAAGAATGCTGTGAACCTGCCCCTGGAACGGGATGCTGAGACCTTTCTGCTGCAGCGTCCCATCATGC
CTTGTAGCCTGGACAAGAGAATCATCCTCATTTTCCACTGTGAATTCTCGTCTGAGCGTGGACCACGAAT
GTGCCGCTTCATCAGGGAACGGGACCGTGCAGCTAACGACTACCCCAGCCTGTACTACCCGGAGATGTAC
ATCCTCAAAGGCGGCTACAAGGAGTTCTTCCCACAGCATCCGAACTTTTGTGAGCCCCAGGACTACCGAC
CCATGAACCACGAGGCTTTCAGGGATGAGCTGAGGAACTTTCGCCTTAAGACTCGCAGCTGGGCTGGGGA
ACGGAGCAGGAGGGAACTTTGTAGCAGGCTGCAAGACCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR208736 representing NM_001111075
Red=Cloning site Green=Tags(s)

MEVPLQKSAPGSALSPARVLGGIQRPRHLSVFEFESDGFLGSPEPTASSSPVTTLTQTMHNLAGLGSEPP
KAQVGSLSFQNRLADLSLSRRTSECSLSSESSESSDAGLCMDSPSPVDPQMAERTFEQAIQAASRVIQNE
QFTIKRFRSLPVRLLEHSPVLQSITNSRALDSWRKTEAGYRAAANSPGEDKENVRFQRPRWRSSRERRCL
TTEWKMEVEELSPVAQSSSLTPVERASEEDDGFVDILESDLKDDEKVPAGMENLISAPLVKKLDKEEEQD
LIMFSKCQRLFRSPSMPCSVIRPILKRLERPQDRDVPVQSKRRKSVTPLEEQQLEEPKARVFRSKSLCHE
IENILDSDHRGLIGDYSKAFLLQTVDGKHQDLKYISPETMVALLTGKFSNIVEKFVIVDCRYPYEYEGGH
IKNAVNLPLERDAETFLLQRPIMPCSLDKRIILIFHCEFSSERGPRMCRFIRERDRAANDYPSLYYPEMY
ILKGGYKEFFPQHPNFCEPQDYRPMNHEAFRDELRNFRLKTRSWAGERSRRELCSRLQDQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001111075
ORF Size 1650 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001111075.1, NM_001111075.2, NM_001111075.3, NM_001111075.4, NP_001104545
RefSeq Size 3028
RefSeq ORF 1653
Locus ID 12531
Cytogenetics 2 F1|2 63.29 cM
MW 63.4 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)