Alpl (NM_007431) Mouse Tagged ORF Clone

CAT#: MR208392

Reviews ()
Write a review
  • TrueORF®

Alpl (Myc-DDK-tagged) - Mouse alkaline phosphatase, liver/bone/kidney (Alpl)



  "NM_007431" in other vectors (3)

Interest in protein/lysate? Submit request here!

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 544.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Alpl
Synonyms Ak; Akp; Akp-2; Akp2; ALP; APTNAP; T; TNAP; TNSALP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR208392 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCTCACCATTTTTAGTACTGGCCATCGGCACCTGCCTTACCAACTCTTTTGTGCCAGAGAAAGAGA
GAGACCCCAGTTACTGGCGACAGCAAGCCCAAGAGACCTTGAAAAATGCCCTGAAACTCCAAAAGCTCAA
CACCAATGTAGCCAAGAATGTCATCATGTTCCTGGGAGATGGTATGGGCGTCTCCACAGTAACCGCTGCC
CGAATCCTTAAGGGCCAGCTACACCACAACACGGGCGAGGAGACCCGGCTGGAGATGGACAAATTCCCCT
TTGTGGCCCTCTCCAAGACATATAACACCAACGCTCAGGTCCCTGACAGCGCGGGCACTGCCACTGCCTA
CTTGTGTGGCGTGAAGGCCAACGAGGGCACAGTGGGAGTGAGCGCAGCCACAGAGCGCACGCGATGCAAC
ACCACTCAGGGCAATGAGGTCACATCCATCCTGCGCTGGGCCAAGGATGCTGGGAAGTCCGTGGGCATTG
TGACTACCACTCGGGTGAACCACGCCACACCCAGTGCAGCCTACGCACACTCGGCCGATCGGGACTGGTA
CTCGGATAACGAGATGCCACCAGAGGCTCTGAGCCAGGGCTGCAAGGACATCGCATATCAGCTAATGCAC
AATATCAAGGATATCGACGTGATCATGGGTGGCGGCCGGAAATACATGTACCCGAAGAACAGAACTGATG
TGGAATACGAACTGGATGAGAAGGCCAGGGGTACAAGGCTAGATGGCCTGGATCTCATCAGTATTTGGAA
GAGCTTTAAACCCAGACACAAGCATTCCCACTATGTCTGGAACCGCACTGAACTGCTGGCCCTTGACCCC
TCCAGGGTGGACTACCTCTTAGGTCTCTTTGAGCCCGGGGACATGCAGTATGAATTGAATCGGAACAACC
TGACTGACCCTTCGCTCTCCGAGATGGTGGAGGTGGCCCTCCGGATCCTGACCAAAAACCTCAAAGGCTT
CTTCTTGCTGGTGGAAGGAGGCAGGATTGACCACGGACATCATGAGGGTAAGGCCAAGCAGGCTCTGCAT
GAAGCAGTGGAGATGGACCAGGCCATTGGCAAGGCAGGCGCCATGACATCCCAGAAAGACACCTTGACTG
TGGTTACTGCTGATCATTCCCACGTTTTCACATTCGGTGGATACACCCCCCGGGGCAACTCCATCTTTGG
TCTGGCTCCCATGGTGAGCGACACGGACAAGAAGCCCTTCACGGCCATCCTATATGGTAACGGGCCTGGC
TACAAGGTGGTGGACGGTGAACGGGAAAATGTCTCCATGGTAGATTACGCTCACAACAACTACCAGGCCC
AGTCCGCTGTTCCCCTGCGCCATGAGACCCACGGTGGAGAAGACGTGGCGGTCTTTGCCAAGGGCCCGAT
GGCACACCTGCTTCACGGCGTCCATGAGCAGAACTACATTCCCCATGTGATGGCGTATGCCTCCTGCATT
GGGGCCAACCTTGACCACTGTGCCTGGGCCGGCTCTGGGAGCGCACCCTCCCCAGGGGCCCTGCTGCTTC
CACTGGCTGTGCTCTCCCTACGCACCCTGTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR208392 protein sequence
Red=Cloning site Green=Tags(s)

MISPFLVLAIGTCLTNSFVPEKERDPSYWRQQAQETLKNALKLQKLNTNVAKNVIMFLGDGMGVSTVTAA
RILKGQLHHNTGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERTRCN
TTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMH
NIKDIDVIMGGGRKYMYPKNRTDVEYELDEKARGTRLDGLDLISIWKSFKPRHKHSHYVWNRTELLALDP
SRVDYLLGLFEPGDMQYELNRNNLTDPSLSEMVEVALRILTKNLKGFFLLVEGGRIDHGHHEGKAKQALH
EAVEMDQAIGKAGAMTSQKDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMVSDTDKKPFTAILYGNGPG
YKVVDGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFAKGPMAHLLHGVHEQNYIPHVMAYASCI
GANLDHCAWAGSGSAPSPGALLLPLAVLSLRTLF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007431
ORF Size 1575 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007431.3
RefSeq Size 2524 bp
RefSeq ORF 1575 bp
Locus ID 11647
UniProt ID P09242
Cytogenetics 4 70.02 cM
MW 57.5 kDa
Gene Summary This gene encodes a preproprotein that is proteolytically cleaved to yield a signal peptide and a proproptein that is subsequently processed to generate the active mature peptide. The encoded protein is a membrane-bound glycosylated enzyme that catalyzes the hydrolysis of phosphate esters at alkaline pH. The mature peptide maintains the ratio of inorganic phosphate to inorganic pyrophosphate required for bone mineralization. Mice that lack this enzyme show symptoms of osteomalacia, softening of the bones. In humans, mutations in this gene are associated with hypophosphatasia, an inherited metabolic bone disease in which deficiency of this enzyme inhibits bone mineralization leading to skeletal defects. Mutations in the mouse gene mirror the symptoms of human hypophosphatasia. A pseudogene of this gene is present on chromosome X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]

Other Versions

Other products for "Alpl"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.