Cyp4f13 (NM_130882) Mouse Tagged ORF Clone

CAT#: MR208371

Cyp4f13 (Myc-DDK-tagged) - Mouse cytochrome P450, family 4, subfamily f, polypeptide 13 (Cyp4f13)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 389.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cyp4f13 (NM_130882) Mouse Tagged ORF Clone
Symbol Cyp4f13
Synonyms 0610030I10Rik; Cypf13
Vector pCMV6-Entry
Sequence Data
>MR208371 representing NM_130882
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTACAGCTATGTCTGTCCTGGCTGGGAATGGGGTCCCTGACTGCCTCTCCGTGGCATCTACTGCTGC
TGGGAGGGGCATCTTGGATTCTAGCCCGAATTCTGGCCTGGATCTATGCCTTCTATGACAACTGCAGTCG
CCTTCGTTGCTTCCCTCAGCCCCCTAAACCGAGCTGGTTCTGGGGTCACTTGGCCTTGATGAAGAACAAC
GAGGAAAGCATGCAGTTCATAACACATCTGGGCCATGACTTCCATGATGTCCACCTCTCTTGGGTTGGAC
CTGTGTACCCAATCCTGCGACTCGTCCACCCGAACTTCATTGCTCCCCTGCTCCAAGCCTCAGCTGCTGT
TGCACCCAAGGAAATGACTCTCTATGGCTTCCTGAAGCCCTGGCTGGGGGATGGGCTCCTGATGAGTGCT
GGTGACAAGTGGAGCCACCACCGACGCCTGCTGACACCTGCCTTTCACTTTGACATCCTGAAGTCCTATG
TGAAGATTTTTAACAAGAGTGTGAACATCATGCATGCTAAGTGGCAGTGCCTGGCCTCCAAGGGCACTTC
CCGTCTGGACATGTTTGAACACATCAGCCTCATGACCTTGGACAGCCTGCAGAAGTGCATCTTCAGTGTC
GACAGCAACTGCCAAGAGTCTGACAGCAAATACATTGCTGCAATCCTGGAACTTAGCTCCCTTGTAGTGA
AACGGCACCGCCAGCCCTTCCTGTACCTGGACCTCCTGTACTATCTCACTGCTGATGGGCGTCGCTTCCG
CAAAGCCTGCGACCTGGTGCACAACTTCACAGATGCTGTCATCAAGGAGAGACGCAGCACCCTCAATACG
CAGGGTGTTGAATTCCTAAAGGCCAAGGCTAAGACCAAAACTTTAGATTTTATTGATGTTCTCTTGATGG
CTGAGGATGAACATGGTAAGGGACTATCGAATGAGGACATCCGAGCAGAGGCTGACACCTTCATGTTTGG
AGGCCATGACACCACCACCAGTGCCCTCTCCTGGATTCTCTACAACCTGGCGAGGCACCCAGAATACCAG
GAGCGCTGCCGGCAGGAGGTTCAGGAGCTGCTGAGGGACCGAGACTCCGAGGAGATTGAATGGGACGACT
TGGCCCAGCTACCCTTCCTGACCATGTGCATCAAGGAGAGTCTGCGGCTGCATCCCCCAGTCTTATTAAT
CTCCCGATGCTGCACCCAGGACGTTCTGCTGCCAGATGGCCGGGCCATCCCCAAAGGGAACATCTGTGTC
ATCAGCATTTTCGGGGTTCACCACAACCCTTCAGTCTGGCCAGACCCTGAGGTCTACAACCCCTTTAGAT
TTGACCCAGAAAACCCACAGAAAAGGTCACCTCTGGCTTTTATTCCCTTCTCAGCGGGGACCAGGAACTG
CATAGGACAGACTTTCGCCATGAGCGAGATAAAGGTAGCGCTGGCGCTGACCCTGCTGCGCTTCCGCATC
CTGCCAGATGACAAGGAGCCGCGCCGGAAGCCAGAGCTGATCCTGCGCGCAGAGGGCGGGCTGTGGCTGC
GGGTGGAGCCGCTGAGCGCCGGCGCACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR208371 representing NM_130882
Red=Cloning site Green=Tags(s)

MLQLCLSWLGMGSLTASPWHLLLLGGASWILARILAWIYAFYDNCSRLRCFPQPPKPSWFWGHLALMKNN
EESMQFITHLGHDFHDVHLSWVGPVYPILRLVHPNFIAPLLQASAAVAPKEMTLYGFLKPWLGDGLLMSA
GDKWSHHRRLLTPAFHFDILKSYVKIFNKSVNIMHAKWQCLASKGTSRLDMFEHISLMTLDSLQKCIFSV
DSNCQESDSKYIAAILELSSLVVKRHRQPFLYLDLLYYLTADGRRFRKACDLVHNFTDAVIKERRSTLNT
QGVEFLKAKAKTKTLDFIDVLLMAEDEHGKGLSNEDIRAEADTFMFGGHDTTTSALSWILYNLARHPEYQ
ERCRQEVQELLRDRDSEEIEWDDLAQLPFLTMCIKESLRLHPPVLLISRCCTQDVLLPDGRAIPKGNICV
ISIFGVHHNPSVWPDPEVYNPFRFDPENPQKRSPLAFIPFSAGTRNCIGQTFAMSEIKVALALTLLRFRI
LPDDKEPRRKPELILRAEGGLWLRVEPLSAGAQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_130882
ORF Size 1569 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_130882.1, NP_570952
RefSeq Size 1731
RefSeq ORF 1572
Locus ID 170716
Cytogenetics 17|17 B1
MW 60.3 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)