Aldh1a2 (NM_009022) Mouse Tagged ORF Clone

CAT#: MR208298

Reviews ()
Write a review
  • TrueORF®

Aldh1a2 (Myc-DDK-tagged) - Mouse aldehyde dehydrogenase family 1, subfamily A2 (Aldh1a2)



  "NM_009022" in other vectors (3)

Interest in protein/lysate? Submit request here!

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 544.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Aldh1a2
Synonyms Aldh1a7; AV116159; Raldh1; Raldh2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR208298 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTTCCAGCGAGATCGCCATGCCGGGCGAGGTGAAGGCCGACCCCGCCGCGCTCATGGCCTCGCTGC
AGCTCCTGCCGTCGCCCACGCCCAACCTCGAGATCAAGTACACCAAGATCTTTATTAACAATGAATGGCA
GAACTCAGAGAGTGGGAGAGTGTTCCCTGTCTGTAATCCAGCCACAGGAGAGCAAGTGTGTGAAGTTCAA
GAAGCAGACAAGGTGGATATAGACAAGGCAGTGCAAGCAGCCCGCCTTGCCTTCTCTCTTGGTTCTGTGT
GGAGAAGGATGGATGCGTCTGAAAGAGGACGTCTGTTGGACAAGCTTGCAGACTTGGTGGAACGGGACAG
GGCAACTCTTGCAACTATGGAATCCCTAAATGGCGGTAAGCCATTCCTGCAAGCTTTTTACATCGATTTG
CAGGGAGTCATCAAAACCCTGAGGTATTATGCAGGCTGGGCTGATAAAATTCACGGAATGACCATTCCTG
TAGATGGAGACTATTTTACTTTCACAAGACACGAGCCCATTGGAGTGTGTGGACAGATCATCCCGTGGAA
CTTCCCCCTGCTGATGTTCACCTGGAAAATTGCTCCCGCATTGTGCTGTGGTAACACCGTGGTCATCAAA
CCCGCTGAGCAGACACCGCTCAGTGCACTGTATATGGGAGCCCTCATCAAGGAGGCTGGCTTTCCACCCG
GAGTCGTCAATATCCTGCCAGGGTATGGGCCAACAGCAGGGGCAGCAATCGCTTCTCACATCGGCATAGA
CAAGATTGCATTCACAGGCTCTACTGAGGTTGGAAAGCTTATTCAAGAAGCAGCTGGAAGAAGTAACCTG
AAGAGAGTGACCCTGGAACTCGGAGGGAAGAGCCCTAATATTATTTTTGCAGATGCTGACTTGGACTACG
CTGTGGAGCAGGCTCACCAGGGTGTGTTCTTCAACCAAGGCCAGTGCTGCACCGCAGGGTCTCGCATCTT
TGTGGAAGAATCCATCTATGAGGAATTTGTGAAAAGAAGTGTGGAAAGGGCCAAGAGGCGCATTGTGGGG
AGCCCCTTTGATCCCACAACTGAGCAGGGTCCTCAGATCGATAAGAAACAATACAACAAAGTCCTGGAGC
TTATCCAGAGCGGTGTGGCTGAGGGCGCCAAGCTGGAGTGCGGAGGCAAAGGGCTGGGAAGGAAGGGCTT
CTTCATTGAGCCCACCGTGTTCTCCAACGTCACTGATGACATGCGGATTGCCAAGGAGGAGATCTTTGGT
CCTGTTCAAGAAATTTTGAGGTTTAAGACTATGGATGAAGTTATAGAAAGAGCCAATAACTCAGACTTTG
GACTTGTAGCAGCTGTCTTCACTAATGACATCAACAAGGCTCTCATGGTATCCTCCGCAATGCAAGCTGG
GACAGTTTGGATCAATTGTTACAATGCCTTAAATGCGCAGAGCCCCTTTGGGGGGTTCAAGATGTCTGGA
AATGGGAGAGAAATGGGTGAGTTTGGCTTACGGGAGTATTCAGAAGTAAAGACCGTGACGGTGAAGATCC
CCCAGAAGAACTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR208298 protein sequence
Red=Cloning site Green=Tags(s)

MTSSEIAMPGEVKADPAALMASLQLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVCNPATGEQVCEVQ
EADKVDIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRATLATMESLNGGKPFLQAFYIDL
QGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIK
PAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNL
KRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERAKRRIVG
SPFDPTTEQGPQIDKKQYNKVLELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG
PVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWINCYNALNAQSPFGGFKMSG
NGREMGEFGLREYSEVKTVTVKIPQKNS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_009022
ORF Size 1557 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_009022.4, NP_033048.2
RefSeq Size 2264 bp
RefSeq ORF 1557 bp
Locus ID 19378
UniProt ID Q62148
Cytogenetics 9 39.85 cM
MW 56.6 kDa
Gene Summary Converts retinaldehyde to retinoic acid (PubMed:8797830). Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal (By similarity). Lacks activity with benzaldehyde, acetaldehyde and octanal (PubMed:8797830). Displays complete lack of activity with citral (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "Aldh1a2"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.