Aldh7a1 (NM_001127338) Mouse Tagged ORF Clone

CAT#: MR208207

Aldh7a1 (Myc-DDK-tagged) - Mouse aldehyde dehydrogenase family 7, member A1 (Aldh7a1), nuclear gene encoding mitochondrial protein, transcript variant 2

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 379.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Aldh7a1 (NM_001127338) Mouse Tagged ORF Clone
Symbol Aldh7a1
Synonyms Atq1; D18Wsu181e
Vector pCMV6-Entry
Sequence Data
>MR208207 representing NM_001127338
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTACTCTGCTGATCCATCATCCCCAGTATGCCTGGCTGCAAGACCTGGGGCTCCGCGAGGATAACG
AGGGCGTGTATAATGGAAGCTGGGGCGGCCGGGGAGAGGTAATTACGACCTATTGTCCTGCTAACAATGA
GCCAATAGCAAGAGTCCGACAGGCCAGCCTGAAGGACTATGAAGAAACCATCGGGAAAGCCAAGAAAGCC
TGGAACATCTGGGCAGATATTCCTGCCCCAAAGCGAGGAGAAATAGTCAGAAAGATTGGCGATGCCTTCC
GGGAGAAGATTCAACTACTGGGAAGACTGGTGTCTTTGGAGATGGGGAAAATCCTCGTGGAAGGAATAGG
CGAGGTTCAGGAGTACGTGGACGTCTGTGACTATGCTGCTGGCTTGTCGAGGATGATCGGGGGACCCACC
TTGCCTTCTGAAAGACCCGGCCATGCTCTCATCGAAATGTGGAATCCCTTAGGCTTGGTGGGAATCATCA
CTGCCTTCAATTTCCCCGTGGCTGTGTTTGGCTGGAACAATGCCATAGCCCTGATCACAGGGAATGTCTG
CCTTTGGAAAGGAGCACCGACTACGTCCCTCGTTAGTGTGGCTGTCACAAAGATCATAGCCCAGGTTTTG
GAGGACAACCTGCTGCCCGGTGCCATTTGTTCCCTGGTTTGTGGTGGAGCAGATATCGGCACAACGATGG
CCAGAGATGAGCGTGTGAACCTGCTGTCCTTCACTGGGAGCACTCAGGTGGGGAAGGAGGTGGCCCTCAT
GGTGCAGGAGAGGTTTGGGAAAAGCTTGTTGGAGCTTGGAGGAAACAACGCCATTATTGCTTTCGAGGAC
GCGGACCTCAGCTTGGTTGTTCCATCAGTTCTGTTTGCCGCCGTGGGAACAGCTGGGCAAAGGTGTACCA
CTGTGAGGCGACTGTTTTTGCACGAAAGCATCCATAATGAAGTTGTGGACAGACTGAGAAGTGCCTACTC
ACAGATCCGTGTCGGGAACCCCTGGGACCCCAATATCCTCTATGGACCGCTCCATACCAAACAGGCAGTG
AGCATGTTTGTGAGAGCCGTGGAAGAAGCCAAGAAACAAGGGGGCACAGTGGTCTATGGGGGCAAGGTCA
TGGACCACCCTGGCAATTACGTGGAACCCACCATTGTGACCGGTCTTGCCCATGATGCGCCCATTGTTCA
CCAGGAGACTTTTGCCCCAATCCTCTATGTCTTCAAATTCCAGGATGAAGAAGAGGTCTTTGAATGGAAC
AATGAAGTAAAACAGGGACTTTCAAGTAGTATCTTTACCAAAGATTTGGGCAGAATCTTCCGCTGGCTTG
GACCTAAAGGTTCCGACTGTGGCATCGTGAACGTCAATATTCCTACCAGCGGGGCTGAGATTGGTGGTGC
GTTTGGCGGAGAGAAGCACACTGGCGGTGGCCGGGAGTCTGGCAGCGACGCCTGGAAGCAGTACATGAGG
AGATCCACATGTACCATCAACTACAGCACGTCCCTCCCTCTGGCTCAGGGAATCAAGTTTCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR208207 representing NM_001127338
Red=Cloning site Green=Tags(s)

MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPANNEPIARVRQASLKDYEETIGKAKKA
WNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLVSLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPT
LPSERPGHALIEMWNPLGLVGIITAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVL
EDNLLPGAICSLVCGGADIGTTMARDERVNLLSFTGSTQVGKEVALMVQERFGKSLLELGGNNAIIAFED
ADLSLVVPSVLFAAVGTAGQRCTTVRRLFLHESIHNEVVDRLRSAYSQIRVGNPWDPNILYGPLHTKQAV
SMFVRAVEEAKKQGGTVVYGGKVMDHPGNYVEPTIVTGLAHDAPIVHQETFAPILYVFKFQDEEEVFEWN
NEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMR
RSTCTINYSTSLPLAQGIKFQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001127338
ORF Size 1533 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001127338.1, NP_001120810
RefSeq Size 3105
RefSeq ORF 1536
Locus ID 110695
Cytogenetics 18 D3|18 30.55 cM
MW 56.1 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)