Cyp4a10 (NM_010011) Mouse Tagged ORF Clone

CAT#: MR208179

Cyp4a10 (Myc-DDK-tagged) - Mouse cytochrome P450, family 4, subfamily a, polypeptide 10 (Cyp4a10)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 389.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cyp4a10 (NM_010011) Mouse Tagged ORF Clone
Symbol Cyp4a10
Synonyms AI647584; Cyp4a; D4Rp1; Msp-3; RP1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR208179 representing NM_010011
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGTCTCTGCTCTAAGCCCAACCCGATTTGCAGACAGCCTCTCTGGCTTCCTCCAAGTGGCCTCTG
TGCTCGGTCTGCTCCTGCTGCTGGTGAAAGCTGTCCAGTTCTACCTCCACAGGCAATGGCTACTCAAGGC
TTTCCAGCAGTTCCCATCACCTCCTTTTCACTGGTTCTTTGGGCATGAGAAGTTCAAAGGTGACCAAGAA
CTACAGGAAATTGTGTCGTGCATAGAGAACTTCCCAAGTGCCTTTCCTAGATGGTTCTGGGGAAGCAAGG
CCTACTTAACTGTCTATGACCCTGACTACATGAAAGTGATTCTGGGGCGATCAGATCCAAAGGCTAATGG
TGCGTACAGATTGCTAGCTCCTTGGATTGGGTATGGTTTGCTCTTGTTGAATGGACAGCCATGGTTCCAG
CACAGGAGGATGCTAACCCCAGCCTTCCACTATGACATTCTGAAACCCTATGTGAAAAACATGGCCGACT
CCATTCGATTGATGCTAGACAAATGGGAACGGCTGGCTGATCAGGACTCCTCTATAGAGATCTTTCAACA
CATCTCCTTAATGACCCTAGACACTGTCATGAAATGTGCCTTCAGCCACAAGGGCAGTGTTCAGGTAGAT
GGAAATTACAGGACCTACCTCCAGGCCATTGGGGACTTGAATAACCTATTTCACTCCCGTGTGAGGAATA
TCTTTCATCAGAATGATACCATCTACAAACTTTCTTCCAATGGCCGCTTGGCCAAACAAGCTTGTCAACT
TGCCCATGATCACACAGATGGAGTGATCAAGCTGAGAAAGGATCAGCTGCAGGATGAGGGAGAGCTGGAA
AAGATCAAGAAGAAGAGACGTTTGGATTTTCTGGATATCCTTTTATTTGCCAGAATGGAGAATGGGGACA
GCATGTCTGACAAGGACCTACGTGCTGAGGTGGACACATTCATGTTCGAGGGCCATGACACCACAGCCAG
TGGAGTCTCCTGGATCTTCTATGCTCTGGCCACACACCCTGATCACCAACAGAGATGCAGAGAGGAAGTT
CAGAGCCTCCTGGGGGATGGATCCTCTATCACCTGGGATCACCTAGACCAGATTCCCTATACCACAATGT
GCATCAAGGAGGCCCTAAGGCTCTACCCACCTGTCCCAGGCATTGTCAGAGAACTCAGTACATCTGTCAC
CTTCCCTGATGGACGCTCTTTACCCAAAGGTGTCCAGGTCACACTCTCCATTTATGGTCTCCACCACAAC
CCGAAGGTGTGGCCAAATCCAGAGGTGTTTGACCCTTCCAGGTTTGCACCAGACTCTCCCCGACACAGCC
ACTCATTCCTGCCCTTCTCAGGAGGAGCCAGGAACTGCATTGGGAAACAATTTGCTATGAGTGAGCTGAA
GGTGATTGTGGCCCTGACACTGCTCCGCTTCGAACTACTGCCAGATCCTACCAGGGTCCCCATGCCCTTA
GCCCGACTTGTGCTGAAGTCCAAAAATGGGATCTACCTACATCTCAAGAAGCTCCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR208179 representing NM_010011
Red=Cloning site Green=Tags(s)

MSVSALSPTRFADSLSGFLQVASVLGLLLLLVKAVQFYLHRQWLLKAFQQFPSPPFHWFFGHEKFKGDQE
LQEIVSCIENFPSAFPRWFWGSKAYLTVYDPDYMKVILGRSDPKANGAYRLLAPWIGYGLLLLNGQPWFQ
HRRMLTPAFHYDILKPYVKNMADSIRLMLDKWERLADQDSSIEIFQHISLMTLDTVMKCAFSHKGSVQVD
GNYRTYLQAIGDLNNLFHSRVRNIFHQNDTIYKLSSNGRLAKQACQLAHDHTDGVIKLRKDQLQDEGELE
KIKKKRRLDFLDILLFARMENGDSMSDKDLRAEVDTFMFEGHDTTASGVSWIFYALATHPDHQQRCREEV
QSLLGDGSSITWDHLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFPDGRSLPKGVQVTLSIYGLHHN
PKVWPNPEVFDPSRFAPDSPRHSHSFLPFSGGARNCIGKQFAMSELKVIVALTLLRFELLPDPTRVPMPL
ARLVLKSKNGIYLHLKKLH

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_010011
ORF Size 1527 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_010011.1, NM_010011.2, NM_010011.3, NP_034141
RefSeq Size 2085
RefSeq ORF 1530
Locus ID 13117
Cytogenetics 4 D1|4 53.05 cM
MW 58.8 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)