Aldh9a1 (NM_019993) Mouse Tagged ORF Clone

CAT#: MR207926

Aldh9a1 (Myc-DDK-tagged) - Mouse aldehyde dehydrogenase 9, subfamily A1 (Aldh9a1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 389.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Aldh9a1 (NM_019993) Mouse Tagged ORF Clone
Symbol Aldh9a1
Synonyms AA139417; Abaldh; ESTM40; TMABA-DH; Tmabadh
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR207926 representing NM_019993
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTACTGGCACCTTCGTCGTGTCGCAGCCGCTCAACTACCGCGGCGGGGCCCGTGTGGAGCCGGTGG
ATGCTTCCGGCACGGAGAAAGCGTTCGAGCCAGCCACCGGCCGAGTGATTGCCACTTTCGCGTGTTCAGG
AGAAAAGGAAGTAAACTTGGCCGTTGAGAATGCAAAGGCTGCCTTTAAACTCTGGAGTAAGAAAAGTGGC
CTGGAGCGCTGCCAAGTCCTCCTAGAGGCTGCCCGGATCATCAAGGAGCGGAAGGATGAAATTGCCACCG
TGGAGACCATCAACAACGGGAAGTCCATATTTGAGGCCCGCCTGGATGTTGACACTTGCTGGCAGTGCCT
GGAATACTATGCAGGGCTGGCTGCATCCATGGCAGGCGAGCACATTCAGCTCCCAGGAGGGTCCTTCGGC
TACACCCGAAGAGAGCCGCTTGGGGTGTGTGTGGGGATAGGAGCATGGAACTATCCCTTCCAGATCGCCT
GTTGGAAGTCTGCTCCGGCTCTGGCTTGTGGTAATGCCATGATCTTTAAGCCTTCTCCCTTCACGCCTGT
GTCTGCTCTGCTCCTGGCTGAGATCTACACCAAAGCGGGTGCGCCTCCGGGGCTCTTCAACGTGGTGCAA
GGTGGGGCTGCCACAGGCCAGTTTCTGTGTCATCATCGCGAGGTGGCCAAAATCTCCTTCACCGGAAGTG
TGCCCACTGGCGTGAAGATCATGGAGATGTCCGCTAAGGGAGTCAAGCCCATTACTTTGGAACTTGGGGG
CAAATCTCCTCTCATCATCTTCTCAGACTGTAATATGGAGAATGCTGTGAAGGGGGCCCTGATGGCCAAC
TTCCTCACACAAGGACAGGTCTGCTGCAATGGGACTAGAGTCTTTGTGCAAAAGGAAATTGCTGATAAAT
TCATAAATGAGGTTGTGAAGCAGACTCAGAAGATAAAACTTGGAGACCCCCTTCTGGAAGATACGAGGAT
GGGCCCACTCATCAACGCCCCACATCTGGAACGAGTCCTCGGGTTTGTCAAGTTGGCAAAGGAGCAGGGT
GCTACTGTGCTGTGTGGTGGAGAGGTGTATGTACCAGAGGACCCCAAATTAAAACATGGATATTACATGA
CACCTTGCATTTTAACTAATTGCAGAGACGACATGACTTGTGTAAAAGAAGAGATCTTTGGACCAGTCAT
GTCCATTTTAACATTTGGAACTGAAGCCGAGGTTCTAGAGCGAGCTAATGACACCACTTTTGGACTAGCA
GCTGGGGTCTTCACCAGGGACATCCAGAGGGCACACCGGGTGGCGGCTGAGCTGCAGGCTGGAACGTGCT
ACATTAACAACTATAATGTCAGCCCAGTGGAGCTGCCCTTTGGTGGCTACAAGAAGTCAGGATTTGGCAG
AGAGAATGGCCGTGTGACGATTGAGTACTACTCTCAGCTGAAGACGGTGTGTGTGGAGATGGGCGACGTG
GAGTCAGCCTTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR207926 representing NM_019993
Red=Cloning site Green=Tags(s)

MSTGTFVVSQPLNYRGGARVEPVDASGTEKAFEPATGRVIATFACSGEKEVNLAVENAKAAFKLWSKKSG
LERCQVLLEAARIIKERKDEIATVETINNGKSIFEARLDVDTCWQCLEYYAGLAASMAGEHIQLPGGSFG
YTRREPLGVCVGIGAWNYPFQIACWKSAPALACGNAMIFKPSPFTPVSALLLAEIYTKAGAPPGLFNVVQ
GGAATGQFLCHHREVAKISFTGSVPTGVKIMEMSAKGVKPITLELGGKSPLIIFSDCNMENAVKGALMAN
FLTQGQVCCNGTRVFVQKEIADKFINEVVKQTQKIKLGDPLLEDTRMGPLINAPHLERVLGFVKLAKEQG
ATVLCGGEVYVPEDPKLKHGYYMTPCILTNCRDDMTCVKEEIFGPVMSILTFGTEAEVLERANDTTFGLA
AGVFTRDIQRAHRVAAELQAGTCYINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDV
ESAF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_019993
ORF Size 1482 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_019993.1, NM_019993.2, NP_064377
RefSeq Size 2834
RefSeq ORF 1557
Locus ID 56752
Cytogenetics 1|1 H2.3
MW 56.3 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)