Fscn1 (NM_007984) Mouse Tagged ORF Clone

CAT#: MR207918

Fscn1 (Myc-DDK-tagged) - Mouse fascin homolog 1, actin bundling protein (Strongylocentrotus purpuratus) (Fscn1)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 269.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Fscn1 (NM_007984) Mouse Tagged ORF Clone
Symbol Fscn1
Synonyms AI663989; Fan1; fascin-1
Vector pCMV6-Entry
Sequence Data
>MR207918 representing NM_007984
Red=Cloning site Blue=ORF Green=Tags(s)

CTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCGCCAACGGCACGGCAGAGGCTGTGCAGATTCAGTTCGGGCTCATCAGCTGCGGCAACAAGTACC
TGACAGCCGAGGCGTTCGGGTTCAAGGTGAACGCATCCGCTAGTAGCTTGAAAAAGAAGCAGATCTGGAC
GCTGGAGCAACCTCCCGATGAGGCGGGCAGCGCGGCCGTGTGTCTGCGCAGCCACCTGGGTCGCTACCTG
GCCGCCGACAAGGACGGCAACGTGACCTGCGAGCGCGAGGTGCCCGACGGCGACTGCCGCTTTCTCGTCG
TGGCGCACGACGACGGCCGCTGGTCGCTGCAGTCCGAGGCTCACCGGCGCTACTTTGGCGGCACCGAGGA
CCGCCTGTCCTGCTTCGCGCAGAGCGTGTCGCCGGCCGAGAAGTGGAGCGTGCACATCGCCATGCACCCG
CAGGTTAACATCTACAGCGTTACCCGCAAGCGCTACGCGCATCTGAGCGCGCGGCCGGCCGACGAGATCG
CGGTAGACCGCGACGTGCCTTGGGGCGTCGACTCGCTCATCACCTTGGCCTTCCAGGACCAACGCTACAG
TGTGCAGACGTCCGACCACCGCTTCCTGCGCCACGACGGGCGCCTTGTGGCACGGCCGGAGCCCGCCACG
GGCTTCACGCTGGAGTTCCGCTCCGGCAAGGTGGCCTTTCGCGACTGCGAAGGTCGCTACCTGGCTCCGT
CCGGGCCCAGCGGCACCCTCAAGGCTGGCAAGGCCACCAAGGTGGGCAAAGATGAGCTCTTCGCCCTGGA
ACAGAGCTGCGCTCAGGTGGTGCTGCAGGCGGCCAACGAGAGGAACGTGTCCACGCGCCAGGGAATGGAC
CTGTCAGCCAATCAGGATGAAGAGACCGATCAGGAGACCTTCCAGCTGGAGATCGACCGCGACACAAGAA
AGTGTGCCTTTCGCACCCACACGGGCAAGTACTGGACACTGACGGCGACCGGAGGTGTGCAATCCACTGC
GTCCACCAAGAACGCCAGCTGCTACTTTGACATCGAGTGGTGTGACCGCCGGATCACTCTGAGAGCCTCC
AACGGCAAGTTTGTGACCGCCAAGAAAAATGGCCAGCTGGCCGCCTCGGTGGAGACAGCAGGGGACTCGG
AACTCTTCCTCATGAAGCTGATTAACCGCCCCATCATCGTGTTCCGGGGGGAACACGGGTTCATTGGCTG
CCGCAAGGTCACGGGCACTCTGGATGCCAACCGTTCCAGTTACGATGTCTTCCAGTTGGAATTCAATGAC
GGCGCCTACAACATCAAAGACTCCACGGGCAAGTACTGGACGGTGGGTAGTGATTCCTCGGTCACCAGCA
GCAGCGACACCCCTGTGGATTTCTTCCTTGAGTTCTGTGACTACAATAAGGTGGCTCTCAAGGTGGGCGG
CCGCTACCTGAAGGGGGACCACGCTGGGGTCCTGAAGGCCTGCGCGGAGACTATCGACCCCGCCTCACTC
TGGGAGTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR207918 representing NM_007984
Red=Cloning site Green=Tags(s)

MTANGTAEAVQIQFGLISCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYL
AADKDGNVTCEREVPDGDCRFLVVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQSVSPAEKWSVHIAMHP
QVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYSVQTSDHRFLRHDGRLVARPEPAT
GFTLEFRSGKVAFRDCEGRYLAPSGPSGTLKAGKATKVGKDELFALEQSCAQVVLQAANERNVSTRQGMD
LSANQDEETDQETFQLEIDRDTRKCAFRTHTGKYWTLTATGGVQSTASTKNASCYFDIEWCDRRITLRAS
NGKFVTAKKNGQLAASVETAGDSELFLMKLINRPIIVFRGEHGFIGCRKVTGTLDANRSSYDVFQLEFND
GAYNIKDSTGKYWTVGSDSSVTSSSDTPVDFFLEFCDYNKVALKVGGRYLKGDHAGVLKACAETIDPASL
WEY

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007984
ORF Size 1479 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007984.1, NM_007984.2, NP_032010
RefSeq Size 2667
RefSeq ORF 1482
Locus ID 14086
Cytogenetics 5 G2|5 81.84 cM
MW 55 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)