Gfra1 (NM_010279) Mouse Tagged ORF Clone

CAT#: MR207481

Gfra1 (Myc-DDK-tagged) - Mouse glial cell line derived neurotrophic factor family receptor alpha 1 (Gfra1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 269.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Gfra1 (NM_010279) Mouse Tagged ORF Clone
Symbol Gfra1
Synonyms AU042498
Vector pCMV6-Entry
Sequence Data
>MR207481 representing NM_010279
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCCTAGCCACTCTGTACTTCGTGCTGCCACTCCTGGATTTGCTGATGTCGGCCGAGGTGAGTGGTG
GGGACCGCCTGGACTGTGTGAAAGCCAGTGATCAGTGCCTGAAGGAACAGAGCTGCAGCACCAAGTACCG
CACACTGAGGCAGTGCGTGGCGGGCAAGGAAACCAACTTCAGCCTGACATCCGGCCTCGAGGCCAAGGAT
GAGTGCCGCAGCGCTATGGAGGCCTTGAAGCAGAAGTCTCTCTACAACTGCCGCTGCAAGCGGGGCATGA
AGAAAGAGAAGAATTGTCTGCGTATCTACTGGAGCATGTACCAGAGCCTGCAGGGAAATGACCTACTGGA
AGATTCCCCATATGAGCCGGTTAACAGCAGGCTGTCAGATATATTCCGGGCAGTCCCGTTCATATCAGAT
GTTTTCCAGCAAGTGGAACACATTTCCAAAGGGAACAACTGCCTCGATGCAGCCAAGGCCTGCAACCTGG
ATGACACCTGCAAGAAGTACAGGTCCGCCTACATCACCCCCTGTACCACCAGCATGTCCAATGAAGTCTG
CAACCGCCGCAAGTGCCACAAAGCCCTCAGGCAGTTCTTCGACAAAGTTCCAGCCAAGCACAGCTACGGG
ATGCTCTTCTGCTCCTGCCGGGACGTCGCCTGCACCGAGAGGCGGCGACAGACTATCGTCCCTGTGTGCT
CCTATGAAGAACGAGAGAGGCCCAACTGCCTGAATCTGCAAGACTCCTGCAAGACAAATTACATCTGCAG
ATCTCGCCTTGCAGATTTTTTTACCAACTGCCAGCCAGAGTCAAGGTCTGTCAGCAACTGTCTTAAGGAG
AACTACGCAGACTGCCTCCTGGCCTACTCGGGACTGATTGGCACAGTCATGACTCCTAACTACATAGACT
CCAGCAGCCTCAGTGTGGCGCCGTGGTGCGATTGCAGCAACAGTGGCAATGACCTGGAAGATTGCCTGAA
GTTTCTGAATTTTTTTAAGGACAATACGTGTCTCAAAAATGCAATTCAAGCCTTTGGCAATGGCTCGGAT
GTGACCATGTGGCAGCCAGCCCCCCCAGTCCAGACCACCACTGCCACGACTACCACTGCCTTCCGGATCA
AGAACAAGCCTCTAGGGCCAGCAGGCTCTGAGAATGAGATTCCCACACACGTTTTACCACCGTGTGCTAA
TTTGCAGGCACAGAAGCTGAAATCCAATGTATCGGGCAGTACACATCTCTGTCTTTCTGATAATGATTAC
GGAAAGGATGGTCTCGCTGGTGCCTCCAGCCACATAACCACAAAATCAATGGCTGCTCCTCCCAGCTGCG
GTCTGAGCTCACTGCCGGTGATGGTGTTCACCGCTCTGGCTGCCCTGTTGTCTGTATCATTGGCAGAAAC
ATCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR207481 representing NM_010279
Red=Cloning site Green=Tags(s)

MFLATLYFVLPLLDLLMSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLTSGLEAKD
ECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDSPYEPVNSRLSDIFRAVPFISD
VFQQVEHISKGNNCLDAAKACNLDDTCKKYRSAYITPCTTSMSNEVCNRRKCHKALRQFFDKVPAKHSYG
MLFCSCRDVACTERRRQTIVPVCSYEERERPNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSNCLKE
NYADCLLAYSGLIGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEDCLKFLNFFKDNTCLKNAIQAFGNGSD
VTMWQPAPPVQTTTATTTTAFRIKNKPLGPAGSENEIPTHVLPPCANLQAQKLKSNVSGSTHLCLSDNDY
GKDGLAGASSHITTKSMAAPPSCGLSSLPVMVFTALAALLSVSLAETS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_010279
ORF Size 1404 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_010279.1, NM_010279.2, NM_010279.3, NP_034409
RefSeq Size 3305
RefSeq ORF 1407
Locus ID 14585
Cytogenetics 19 D2|19 54.18 cM
MW 52.2 kDa
Gene Summary This gene encodes a transmembrane protein that functions as the receptor for glial cell line derived neurotrophic factor (GDNF). The encoded protein undergoes proteolytic processing to generate a glycosylphosphatidylinositol-anchored cell surface coreceptor that forms a complex with the Ret tyrosine kinase in GDNF signaling pathway. Mice lacking the encoded protein exhibit deficits in the kidneys, the enteric nervous system, and spinal motor and sensory neurons similar mice deficient in GDNF or Ret. [provided by RefSeq, Jul 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)