Eef1a1 (NM_010106) Mouse Tagged ORF Clone

CAT#: MR207381

Eef1a1 (Myc-DDK-tagged) - Mouse eukaryotic translation elongation factor 1 alpha 1 (Eef1a1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 269.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Eef1a1 (NM_010106) Mouse Tagged ORF Clone
Symbol Eef1a1
Synonyms MGC102592; MGC103271; MGC118397; MGC18758; MGC27859; MGC7551; MGC8115; MGC8209
Vector pCMV6-Entry
Sequence Data
>MR207381 representing NM_010106
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAAAGGAAAAGACTCACATCAACATCGTCGTAATCGGACACGTAGATTCCGGCAAGTCCACCACAA
CCGGCCACCTGATCTACAAATGTGGTGGAATCGACAAGCGAACCATCGAAAAGTTTGAGAAAGAGGCTGC
TGAGATGGGAAAGGGCTCCTTCAAGTACGCCTGGGTCTTAGACAAACTGAAAGCTGAGCGTGAGCGTGGT
ATCACTATTGACATCTCCCTGTGGAAATTCGAGACCAGCAAATACTATGTGACCATCATTGATGCCCCAG
GACACAGAGACTTCATCAAAAACATGATTACAGGCACATCCCAGGCTGACTGTGCTGTCCTGATTGTTGC
TGCTGGTGTTGGTGAATTTGAAGCTGGTATCTCCAAGAACGGGCAGACCCGCGAGCATGCTCTTCTGGCT
TACACCCTGGGTGTGAAACAGCTGATTGTTGGTGTCAACAAAATGGATTCCACCGAGCCACCATACAGTC
AGAAGAGATACGAGGAAATCGTTAAGGAAGTCAGCACCTACATTAAGAAAATTGGCTACAACCCTGACAC
AGTAGCATTTGTGCCAATTTCTGGTTGGAATGGTGACAACATGCTGGAGCCAAGTGCTAATATGCCTTGG
TTCAAGGGATGGAAAGTCACCCGCAAAGATGGCAGTGCCAGTGGCACCACGCTGCTGGAAGCTTTGGATT
GTATCCTACCACCAACTCGTCCAACTGACAAGCCTCTGCGACTGCCCCTCCAGGATGTCTATAAAATTGG
AGGCATTGGCACTGTCCCTGTGGGCCGAGTGGAGACTGGTGTTCTCAAACCTGGCATGGTGGTTACCTTT
GCTCCAGTCAATGTAACAACTGAAGTCAAGTCTGTTGAAATGCACCATGAAGCTTTGAGTGAAGCTCTTC
CTGGGGACAATGTGGGCTTCAATGTAAAGAACGTGTCGGTCAAAGATGTTAGACGAGGCAATGTTGCTGG
TGACAGCAAAAACGACCCACCAATGGAAGCAGCTGGCTTCACTGCTCAGGTGATTATCCTGAACCATCCA
GGCCAAATCAGTGCTGGCTACGCTCCTGTTCTGGATTGTCACACAGCCCACATAGCATGCAAGTTTGCTG
AGCTTAAAGAAAAGATCGATCGTCGTTCTGGTAAGAAGCTGGAAGATGGCCCCAAGTTCCTGAAGTCTGG
CGATGCTGCCATTGTTGATATGGTCCCTGGCAAGCCCATGTGTGTTGAGAGCTTCTCTGACTACCCTCCA
CTTGGTCGCTTTGCTGTTCGTGACATGAGGCAGACAGTTGCTGTGGGTGTCATCAAAGCTGTGGACAAGA
AGGCTGCTGGAGCTGGCAAAGTCACCAAGTCTGCCCAGAAAGCTCAGAAGGCTAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR207381 representing NM_010106
Red=Cloning site Green=Tags(s)

MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERG
ITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA
YTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPW
FKGWKVTRKDGSASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF
APVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP
GQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_010106
ORF Size 1386 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_010106.1, NM_010106.2, NP_034236
RefSeq Size 1790
RefSeq ORF 1389
Locus ID 13627
Cytogenetics 9|9 E1
MW 50.6 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)