Arrb2 (NM_145429) Mouse Tagged ORF Clone

CAT#: MR206444

  • TrueORF®

Arrb2 (Myc-DDK-tagged) - Mouse arrestin, beta 2 (Arrb2)



  "NM_145429" in other vectors (4)

Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "Arrb2"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Arrb2
Synonyms AI326910; Arr3; AW122872
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR206444 representing NM_145429
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAGAAAAACCCGGGACCAGGGTCTTCAAGAAGTCCAGCCCTAACTGCAAGCTCACCGTGTACTTGG
GCAAGCGCGACTTTGTAGATCACCTGGACAAAGTGGACCCTGTGGATGGCGTGGTGCTTGTGGATCCTGA
CTACTTGAAGGACCGGAAAGTGTTCGTGACCCTCACCTGTGCCTTCCGCTATGGCCGAGAAGACCTGGAT
GTACTGGGCCTGTCTTTCCGCAAAGATCTGTTCATCGCCACCTACCAGGCCTTCCCCCCCATGCCCAACC
CACCTCGGCCCCCCACCCGCCTACAGGACCGACTGCTGAAGAAGTTGGGCCAACACGCCCACCCCTTCTT
TTTCACGATACCCCAAAATTTGCCTTGTTCCGTCACACTGCAGCCAGGACCAGAGGACACAGGGAAGGCT
TGTGGAGTAGACTTTGAGATTCGAGCTTTCTGTGCCAAATCAATAGAAGAAAAAAGTCACAAAAGGAACT
CTGTGCGGCTTATCATCAGAAAGGTACAGTTTGCTCCTGAGACACCCGGTCCCCAGCCCTCAGCTGAAAC
CACACGCCACTTCCTCATGTCTGACCGGAGGTCCCTCCACCTAGAGGCTTCCCTGGACAAAGAGCTGTAC
TACCACGGGGAGCCCCTTAATGTCAACGTCCATGTCACCAACAATTCTGCCAAGACCGTCAAGAAGATCA
GAGTGTCTGTGAGACAGTACGCCGACATTTGCCTCTTCAGCACCGCGCAGTACAAGTGTCCCGTGGCTCA
GCTAGAACAAGATGACCAGGTGTCTCCTAGTTCCACGTTCTGCAAGGTGTACACCATCACCCCGCTGCTC
AGTGACAACCGAGAGAAGCGTGGCCTTGCCTTGGATGGGCAGCTCAAACATGAAGACACCAACCTGGCTT
CCAGCACCATTGTGAAGGAGGGAGCCAACAAGGAGGTGCTGGGGATCCTGGTATCCTACAGGGTCAAGGT
GAAGCTGGTGGTGTCTCGAGGCGGAGATGTCTCCGTGGAGCTACCCTTCGTCCTAATGCACCCCAAGCCC
CATGACCACATCACCCTTCCCAGACCCCAGTCAGCCCCCCGGGAAACAGACGTGCCTGTGGATACCAACC
TCATCGAATTCGATACCAACTATGCCACAGACGATGACATCGTGTTTGAGGACTTTGCCCGGCTCCGGCT
GAAGGGAATGAAGGATGATGACTGTGATGACCAGTTCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR206444 representing NM_145429
Red=Cloning site Green=Tags(s)

MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLD
VLGLSFRKDLFIATYQAFPPMPNPPRPPTRLQDRLLKKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKA
CGVDFEIRAFCAKSIEEKSHKRNSVRLIIRKVQFAPETPGPQPSAETTRHFLMSDRRSLHLEASLDKELY
YHGEPLNVNVHVTNNSAKTVKKIRVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLL
SDNREKRGLALDGQLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKP
HDHITLPRPQSAPRETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDCDDQFC

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_145429
ORF Size 1230 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_145429.1
RefSeq Size 1729 bp
RefSeq ORF 1233 bp
Locus ID 216869
UniProt ID Q91YI4
Cytogenetics 11 42.99 cM
MW 46.8 kDa
Gene Summary Functions in regulating agonist-mediated G-protein coupled receptor (GPCR) signaling by mediating both receptor desensitization and resensitization processes. During homologous desensitization, beta-arrestins bind to the GPRK-phosphorylated receptor and sterically preclude its coupling to the cognate G-protein; the binding appears to require additional receptor determinants exposed only in the active receptor conformation. The beta-arrestins target many receptors for internalization by acting as endocytic adapters (CLASPs, clathrin-associated sorting proteins) and recruiting the GPRCs to the adapter protein 2 complex 2 (AP-2) in clathrin-coated pits (CCPs). However, the extent of beta-arrestin involvement appears to vary significantly depending on the receptor, agonist and cell type. Internalized arrestin-receptor complexes traffic to intracellular endosomes, where they remain uncoupled from G-proteins. Two different modes of arrestin-mediated internalization occur. Class A receptors, like ADRB2, OPRM1, ENDRA, D1AR and ADRA1B dissociate from beta-arrestin at or near the plasma membrane and undergo rapid recycling. Class B receptors, like AVPR2, AGTR1, NTSR1, TRHR and TACR1 internalize as a complex with arrestin and traffic with it to endosomal vesicles, presumably as desensitized receptors, for extended periods of time. Receptor resensitization then requires that receptor-bound arrestin is removed so that the receptor can be dephosphorylated and returned to the plasma membrane. Mediates endocytosis of CCR7 following ligation of CCL19 but not CCL21. Involved in internalization of P2RY1, P2RY4, P2RY6 and P2RY11 and ATP-stimulated internalization of P2RY2. Involved in phosphorylation-dependent internalization of OPRD1 and subsequent recycling or degradation. Involved in ubiquitination of IGF1R. Beta-arrestins function as multivalent adapter proteins that can switch the GPCR from a G-protein signaling mode that transmits short-lived signals from the plasma membrane via small molecule second messengers and ion channels to a beta-arrestin signaling mode that transmits a distinct set of signals that are initiated as the receptor internalizes and transits the intracellular compartment. Acts as signaling scaffold for MAPK pathways such as MAPK1/3 (ERK1/2) and MAPK10 (JNK3). ERK1/2 and JNK3 activated by the beta-arrestin scaffold are largely excluded from the nucleus and confined to cytoplasmic locations such as endocytic vesicles, also called beta-arrestin signalosomes. Acts as signaling scaffold for the AKT1 pathway. GPCRs for which the beta-arrestin-mediated signaling relies on both ARRB1 and ARRB2 (codependent regulation) include ADRB2, F2RL1 and PTH1R. For some GPCRs the beta-arrestin-mediated signaling relies on either ARRB1 or ARRB2 and is inhibited by the other respective beta-arrestin form (reciprocal regulation). Increases ERK1/2 signaling in AGTR1- and AVPR2-mediated activation (reciprocal regulation). Involved in CCR7-mediated ERK1/2 signaling involving ligand CCL19. Is involved in type-1A angiotensin II receptor/AGTR1-mediated ERK activity. Is involved in type-1A angiotensin II receptor/AGTR1-mediated MAPK10 activity. Is involved in dopamine-stimulated AKT1 activity in the striatum by disrupting the association of AKT1 with its negative regulator PP2A. Involved in AGTR1-mediated chemotaxis. Appears to function as signaling scaffold involved in regulation of MIP-1-beta-stimulated CCR5-dependent chemotaxis. Involved in attenuation of NF-kappa-B-dependent transcription in response to GPCR or cytokine stimulation by interacting with and stabilizing CHUK. Suppresses UV-induced NF-kappa-B-dependent activation by interacting with CHUK. The function is promoted by stimulation of ADRB2 and dephosphorylation of ARRB2. Involved in IL8-mediated granule release in neutrophils (By similarity). Involved in p53/TP53-mediated apoptosis by regulating MDM2 and reducing the MDM2-mediated degradation of p53/TP53. May serve as nuclear messenger for GPCRs. Upon stimulation of OR1D2, may be invol

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.