Golm1 (NM_027307) Mouse Tagged ORF Clone

CAT#: MR206131

Golm1 (Myc-DDK-tagged) - Mouse golgi membrane protein 1 (Golm1), transcript variant 1

Change vector?

  • TrueORF®

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Golm1 (NM_027307) Mouse Tagged ORF Clone
Symbol Golm1
Synonyms 2310001L02Rik; AW125446; D030064E01Rik; Golph2; GP73; PSEC0257
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR206131 representing NM_027307
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGGATTGGGGAATGGGCGTCGCAGCATGAAGTCTCCGCCCCTTATCCTGGCTGCCCTGGTGGCCT
GTGTTATTGTGCTAGACTTCAACTACTGGATTGCTAGCTCGAGAAGCGCGGAACTCCAGACGCGCATTGT
AGAGCTGGAAGGCCGGGTCCGCAGGGCGGCTGCAGAGAGAGGTGCTGTAGAGCTCAAGAAGAATGAGTTC
CAGGGCGAGCTGCAGAAGCAGAGAGAGCAACTTGACAGGATCCAGTCTAGCCACAGCTTCCAGCTGGAGA
ATGTCAACAAGCTACACCAGGATGAGAAGGCGGTTTTAGTGAATAACATCACCACAGGCGAGAAGCTCAT
TCGAGACCTGCAAGACCAGTTGAAGGCACTGCAGAGGAGTTACAGCAGCCTGCAGCAGGATATCTTCCAA
TTCCAGAAGAACCAGACCAGCCTGGAGAAGAAGTTCTCCTATGACCTGAACCAGTGTATCAGCCAGATGA
CCGAGGTGAAGGAACAGTGTGACGAGCGGATAGAGGAGGTCATCAGAAAGCGAAACGAAGCACCGGGTTC
CAGAGACCTGGCTGAAACCAACAACCAACATCAGCAGGCCCTCAAGCCTCAGCCCAAGCTTCAGGAAGAA
GTCCCATCAGAGGAACAGATGCCACAAGAGAAAGGGGATGTGCCCAGAAACAAGTCCCAGATTCCAGCCC
CCAATTCAGAGAGCTTGGGCTTGAAGCCACAGGTGCAGAATGAGGAAACCGATGAGATTCAGGCTGTCGG
TGAGGAGCACCAACAGGCATCCATCCAAGGGCAGGCGGTGGCGGATGGCACTCGGGTAGGAGCTGAGAAA
CTCGATCAGCACACACAGCTACCAGCTGGCCTGTTGGCCAGGCCTGAGGAGGACTCTCAGTACCCTGAGC
GGGAGCAGCTTGTCATCCGGGATAGGCAGGAGCAGCAGCGTGCATCAGAGGAAGGGGGAGGCCAGAAGAA
CCCAGGAGATGAATACGACATGGATGAAAACGAAGCAGAATCTGAGAGGGAGAAGCAGGCAGCCCTTGCA
GGGAATGACAGAAATATAAATGTTCTTAATGCTGACGCTCAGAAGAGAGGCATAATAAATGTGCCCGTCG
GGAGTGAAAGGCAGAGCCACATTCTAAATCAAGTAGGCATTCATATTCCTCAACAAGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR206131 representing NM_027307
Red=Cloning site Green=Tags(s)

MMGLGNGRRSMKSPPLILAALVACVIVLDFNYWIASSRSAELQTRIVELEGRVRRAAAERGAVELKKNEF
QGELQKQREQLDRIQSSHSFQLENVNKLHQDEKAVLVNNITTGEKLIRDLQDQLKALQRSYSSLQQDIFQ
FQKNQTSLEKKFSYDLNQCISQMTEVKEQCDERIEEVIRKRNEAPGSRDLAETNNQHQQALKPQPKLQEE
VPSEEQMPQEKGDVPRNKSQIPAPNSESLGLKPQVQNEETDEIQAVGEEHQQASIQGQAVADGTRVGAEK
LDQHTQLPAGLLARPEEDSQYPEREQLVIRDRQEQQRASEEGGGQKNPGDEYDMDENEAESEREKQAALA
GNDRNINVLNADAQKRGIINVPVGSERQSHILNQVGIHIPQQA

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_027307
ORF Size 1179 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_027307.1, NM_027307.2, NM_027307.3, NM_027307.4, NP_081583
RefSeq Size 3693
Locus ID 105348
Cytogenetics 13|13 B2
MW 44.8 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.