Acta2 (NM_007392) Mouse Tagged ORF Clone

CAT#: MR205873

Acta2 (Myc-DDK-tagged) - Mouse actin, alpha 2, smooth muscle, aorta (Acta2)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Acta2 (NM_007392) Mouse Tagged ORF Clone
Symbol Acta2
Synonyms 0610041G09Rik; a-SMA; Actvs; alphaSMA; SMalphaA
Vector pCMV6-Entry
Sequence Data
>MR205873 representing NM_007392
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGTGAAGAGGAAGACAGCACAGCCCTGGTGTGCGACAATGGCTCTGGGCTCTGTAAGGCCGGCTTCG
CTGGTGATGATGCTCCCAGGGCTGTTTTCCCATCCATCGTGGGACGTCCCAGACATCAGGGAGTAATGGT
TGGAATGGGCCAAAAAGACAGCTATGTGGGGGATGAAGCCCAGAGCAAGAGAGGGATCCTGACGCTGAAG
TATCCGATAGAACACGGCATCATCACCAACTGGGACGACATGGAAAAGATCTGGCACCACTCTTTCTATA
ACGAGCTTCGTGTGGCCCCTGAAGAGCATCCGACACTGCTGACAGAGGCACCACTGAACCCTAAGGCCAA
CCGGGAGAAAATGACCCAGATTATGTTTGAGACCTTCAATGTCCCCGCCATGTATGTGGCTATTCAGGCT
GTGCTGTCCCTCTATGCCTCTGGACGTACAACTGGTATTGTGCTGGACTCTGGAGATGGTGTGACTCACA
ACGTGCCTATCTATGAGGGCTATGCCCTGCCTCATGCCATCATGCGTCTGGACTTGGCTGGCCGAGATCT
CACCGACTACCTCATGAAGATCCTGACTGAGCGTGGCTATTCCTTCGTGACTACTGCCGAGCGTGAGATT
GTCCGTGACATCAAGGAGAAGCTGTGCTATGTAGCTCTGGACTTTGAAAATGAGATGGCCACGGCCGCCT
CCTCTTCCTCCCTGGAGAAGAGCTACGAACTGCCTGACGGGCAGGTGATCACCATTGGAAACGAACGCTT
CCGCTGCCCAGAGACTCTCTTCCAGCCATCTTTCATTGGGATGGAGTCAGCGGGCATCCACGAAACCACC
TATAACAGCATCATGAAGTGTGATATTGACATCAGGAAGGATCTCTATGCTAACAACGTCCTGTCAGGGG
GTACCACCATGTACCCAGGCATTGCTGACAGGATGCAGAAGGAGATCACAGCCCTCGCACCCAGCACCAT
GAAGATCAAGATCATTGCCCCTCCAGAACGCAAGTACTCTGTCTGGATCGGTGGCTCCATCCTGGCTTCG
CTGTCTACCTTCCAGCAGATGTGGATCAGCAAACAGGAATACGACGAAGCTGGGCCCTCCATCGTCCACC
GCAAATGCTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR205873 representing NM_007392
Red=Cloning site Green=Tags(s)

MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK
YPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA
VLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI
VRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETT
YNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS
LSTFQQMWISKQEYDEAGPSIVHRKCF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007392
ORF Size 1131 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007392.1, NM_007392.2, NM_007392.3, NP_031418
RefSeq Size 1780
RefSeq ORF 1134
Locus ID 11475
Cytogenetics 19|19 C1
MW 42.5 kDa
Gene Summary The protein encoded by this gene belongs to the actin family of proteins, which are highly conserved proteins that play a role in cell motility, structure and integrity. Alpha, beta and gamma actin isoforms have been identified, with alpha actins being a major constituent of the contractile apparatus, while beta and gamma actins are involved in the regulation of cell motility. This actin is an alpha actin that is found in skeletal muscle. [provided by RefSeq, Sep 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)