Dcx (NM_001110224) Mouse Tagged ORF Clone

CAT#: MR205614

Dcx (Myc-DDK-tagged) - Mouse doublecortin (Dcx), transcript variant 3

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 219.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name Dcx (NM_001110224) Mouse Tagged ORF Clone
Symbol Dcx
Synonyms Dbct
Vector pCMV6-Entry
Sequence Data
>MR205614 representing NM_001110224
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAACTTGATTTTGGACATTTTGACGAACGAGACAAAGCATCTAGAAATATGAGAGGGTCACGGATGA
ATGGACTTCCAAGTCCCACTCATAGTGCCCACTGTAGCTTCTACAGAACCAGAACCTTGCAGGCATTAAG
TAATGAGAAGAAGGCCAAGAAGGTACGTTTCTACCGCAATGGGGACCGTTACTTCAAGGGGATTGTGTAC
GCTGTTTCTTCTGACCGTTTTCGTAGTTTTGATGCGTTGCTGGCTGACCTGACCCGATCCTTGTCTGACA
ACATTAACCTGCCTCAGGGAGTGCGCTACATTTATACCATTGACGGATCCAGGAAGATTGGAAGCATGGA
TGAACTGGAAGAAGGGGAAAGCTATGTCTGCTCCTCAGACAACTTCTTTAAAAAGGTTGAGTACACCAAG
AATGTCAACCCCAACTGGTCTGTCAACGTAAAGACATCTGCCAACATGAAAGCCCCCCAGTCCTTGGCTA
GCAGCAACAGTGCTCAAGCCAGAGAGAACAAGGACTTTGTGCGCCCCAAACTTGTGACCATCATTCGCAG
CGGGGTGAAGCCACGGAAGGCTGTGCGCGTGCTTCTCAACAAGAAAACAGCCCACTCTTTCGAGCAGGTC
CTGACTGACATCACAGAAGCGATCAAACTGGAAACCGGAGTTGTCAAAAAACTCTACACCCTTGATGGAA
AGCAGGTCACCTGTCTCCATGATTTCTTTGGTGATGATGATGTGTTCATTGCTTGTGGTCCTGAAAAATT
CCGCTATGCTCAAGATGATTTCTCCTTGGATGAGAATGAATGCAGAGTCATGAAAGGGAATCCATCTGCC
GCAGCTGGCCCAAAGGCTTCCCCAACACCTCAAAAGACATCTGCTAAAAGCCCAGGCCCAATGCGCCGCA
GCAAGTCTCCAGCTGACTCAGGTAACGACCAAGACGCAAATGGAACTTCCAGCAGTCAGCTCTCAACACC
TAAGTCAAAGCAGTCTCCTATCTCTACACCCACAAGCCCTGGAAGTCTGCGGAAGCACAAGGACCTGTAC
CTGCCGCTGTCATTGGATGACTCTGATTCACTTGGCGATTCCATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR205614 representing NM_001110224
Red=Cloning site Green=Tags(s)

MELDFGHFDERDKASRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVY
AVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTK
NVNPNWSVNVKTSANMKAPQSLASSNSAQARENKDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQV
LTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSA
AAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLY
LPLSLDDSDSLGDSM

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001110224
ORF Size 1095 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001110224.1, NP_001103694
RefSeq Size 8997
RefSeq ORF 1098
Locus ID 13193
Cytogenetics X|X F2
MW 41 kDa
Gene Summary This gene encodes a member of the doublecortin family. The protein encoded by this gene is a cytoplasmic protein and contains two doublecortin domains, which bind microtubules. In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. The encoded protein appears to direct neuronal migration by regulating the organization and stability of microtubules. In addition, the encoded protein interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase. Studies in knockout mice lacking this gene and the LIS1 gene suggest that the molecular interaction of these two genes is important in both in neuronal migration and neurogenesis, and there is a cortical role of this gene in nuclear translocation and positioning of the mitotic spindle in radial glial mitotic division. Multiple transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Sep 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)