Anxa1 (NM_010730) Mouse Tagged ORF Clone

CAT#: MR205210

  • TrueORF®

Anxa1 (Myc-DDK-tagged) - Mouse annexin A1 (Anxa1)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_010730" in other vectors (5)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Anxa1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Anxa1
Synonyms Anx-1; Anx-A1; C430014K04Rik; Lpc-1; Lpc1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR205210 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAATGGTATCAGAATTCCTCAAGCAAGCCCGTTTTCTTGAAAATCAAGAACAGGAATATGTTCAAG
CTGTAAAATCATACAAAGGTGGTCCTGGGTCAGCAGTGAGCCCCTACCCTTCCTTCAATGTATCCTCGGA
TGTTGCTGCCTTGCACAAAGCTATCATGGTTAAAGGTGTGGATGAAGCAACCATCATTGACATTCTTACC
AAGAGGACCAATGCTCAGCGCCAGCAGATCAAGGCCGCGTACTTACAGGAGAATGGAAAGCCCTTGGATG
AAGTCTTGAGAAAAGCCCTTACAGGCCACCTGGAGGAGGTTGTTTTGGCTATGCTAAAAACTCCAGCTCA
GTTTGATGCAGATGAACTCCGTGGTGCCATGAAGGGACTTGGAACAGATGAAGACACTCTCATTGAGATT
TTGACAACAAGATCTAACGAACAAATCAGAGAGATTAATAGAGTCTACAGAGAAGAACTGAAAAGAGATC
TGGCCAAAGACATCACTTCAGATACATCTGGAGACTTTCGGAAAGCCTTGCTTGCTCTTGCCAAGGGTGA
CCGTTGTCAGGACTTGAGTGTGAATCAAGATTTGGCTGATACGGATGCCAGGGCTTTGTATGAAGCTGGA
GAAAGGAGAAAGGGGACAGACGTGAACGTGTTCACTACAATTCTGACCAGTAGGAGCTTTCCTCATCTTC
GCAGAGTGTTTCAGAATTACGGAAAGTACAGTCAACATGACATGAACAAAGCTCTGGATCTGGAACTGAA
GGGTGACATTGAGAAGTGCCTCACAACCATCGTGAAGTGTGCCACCAGCACTCCAGCTTTCTTTGCCGAG
AAGCTGTACGAAGCCATGAAGGGTGCCGGAACTCGCCATAAGGCATTGATCAGGATTATGGTCTCCCGTT
CGGAAATTGACATGAATGAAATCAAAGTATTTTACCAGAAGAAGTATGGAATCTCTCTTTGCCAAGCCAT
CCTGGATGAAACCAAAGGAGACTATGAAAAAATCCTGGTGGCTCTGTGTGGTGGAAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR205210 protein sequence
Red=Cloning site Green=Tags(s)

MAMVSEFLKQARFLENQEQEYVQAVKSYKGGPGSAVSPYPSFNVSSDVAALHKAIMVKGVDEATIIDILT
KRTNAQRQQIKAAYLQENGKPLDEVLRKALTGHLEEVVLAMLKTPAQFDADELRGAMKGLGTDEDTLIEI
LTTRSNEQIREINRVYREELKRDLAKDITSDTSGDFRKALLALAKGDRCQDLSVNQDLADTDARALYEAG
ERRKGTDVNVFTTILTSRSFPHLRRVFQNYGKYSQHDMNKALDLELKGDIEKCLTTIVKCATSTPAFFAE
KLYEAMKGAGTRHKALIRIMVSRSEIDMNEIKVFYQKKYGISLCQAILDETKGDYEKILVALCGGN

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_010730
ORF Size 1041 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_010730.2, NP_034860.2
RefSeq Size 1395 bp
RefSeq ORF 1041 bp
Locus ID 16952
UniProt ID P10107
Cytogenetics 19 13.83 cM
MW 38.7 kDa
Gene Summary Plays important roles in the innate immune response as effector of glucocorticoid-mediated responses and regulator of the inflammatory process. Has anti-inflammatory activity (PubMed:12475898). Plays a role in glucocorticoid-mediated down-regulation of the early phase of the inflammatory response (PubMed:12475898). Promotes resolution of inflammation and wound healing (PubMed:25664854). Functions at least in part by activating the formyl peptide receptors and downstream signaling cascades. Promotes chemotaxis of granulocytes and monocytes via activation of the formyl peptide receptors (By similarity). Contributes to the adaptive immune response by enhancing signaling cascades that are triggered by T-cell activation, regulates differentiation and proliferation of activated T-cells (PubMed:17948261). Promotes the differentiation of T-cells into Th1 cells and negatively regulates differentiation into Th2 cells (PubMed:17948261). Has no effect on unstimulated T-cells. Promotes rearrangement of the actin cytoskeleton, cell polarization and cell migration. Negatively regulates hormone exocytosis via activation of the formyl peptide receptors and reorganization of the actin cytoskeleton (By similarity). Has high affinity for Ca(2+) and can bind up to eight Ca(2+) ions (By similarity). Displays Ca(2+)-dependent binding to phospholipid membranes (By similarity). Plays a role in the formation of phagocytic cups and phagosomes (PubMed:21245195). Plays a role in phagocytosis by mediating the Ca(2+)-dependent interaction between phagosomes and the actin cytoskeleton (PubMed:21245195).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.