Fbp1 (NM_019395) Mouse Tagged ORF Clone

CAT#: MR205054

Fbp1 (Myc-DDK-tagged) - Mouse fructose bisphosphatase 1 (Fbp1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 219.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Fbp1 (NM_019395) Mouse Tagged ORF Clone
Symbol Fbp1
Synonyms Fbp-2; Fbp2; Fbp3
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR205054 representing NM_019395
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGAACCATGCGCCCTTCGAAACGGATATCAGCACCCTGACCCGCTTCGTCATGGAGCAGGGCAGGA
AGGCTCAGGGCACGGGGGAGTTGACCCAGCTGCTGAATTCGCTCTGCACCGCGATCAAAGCCATCTCGTC
TGCGGTGCGCCAGGCGGGCATCGCACAGCTCTATGGTATCGCTGGCTCAACCAATGTGACTGGGGATCAA
GTAAAGAAGCTGGACATACTTTCCAATGACCTGGTGATCAATATGCTGAAGTCGTCCTACGCTACCTGTG
TTCTTGTGTCTGAAGAAAACACAAATGCCATCATAATCGAACCTGAGAAGAGGGGCAAATATGTTGTCTG
TTTCGATCCCCTTGATGGCTCATCCAACATTGACTGCCTTGTGTCCATCGGAACCATTTTTGGCATTTAC
AGAAAGAAAAGTACTGATGAGCCTTCTGAGAAGGATGCTCTGCAGCCCGGCCGGGACCTGGTGGCAGCCG
GGTATGCGCTCTATGGCAGTGCCACCATGTTGGTCCTTGCCATGGATTGTGGTGTCAACTGCTTCATGCT
GGACCCGTCCATTGGAGAATTCATTATGGTGGACAGGGACGTGAAGATGAAGAAGAAAGGTAACATCTAC
AGCCTTAATGAGGGTTATGCCAAGGACTTTGACCCTGCCATCAATGAGTATCTCCAGAGGAAAAAGTTCC
CTCCGGATGGTTCAGCCCCCTATGGTGCCCGGTATGTGGGGTCCATGGTGGCTGATATTCACCGCACTCT
GGTATATGGAGGGATCTTTTTATACCCCGCCAACAAGAAAAGCCCAAGTGGAAAGCTGCGGCTGCTGTAT
GAGTGCAACCCCATAGCTTATGTCATGGAGAAGGCCGGTGGGCTCGCCACCACGGGGGACAAAGATATAT
TAGACATCGTTCCCACCGAGATCCACCAGAAGGCACCAGTCGTCATGGGGTCCTCTGAAGATGTGCAGGA
GTTCCTGGAGATCTACAGGAAGCACAAAGCCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR205054 representing NM_019395
Red=Cloning site Green=Tags(s)

MANHAPFETDISTLTRFVMEQGRKAQGTGELTQLLNSLCTAIKAISSAVRQAGIAQLYGIAGSTNVTGDQ
VKKLDILSNDLVINMLKSSYATCVLVSEENTNAIIIEPEKRGKYVVCFDPLDGSSNIDCLVSIGTIFGIY
RKKSTDEPSEKDALQPGRDLVAAGYALYGSATMLVLAMDCGVNCFMLDPSIGEFIMVDRDVKMKKKGNIY
SLNEGYAKDFDPAINEYLQRKKFPPDGSAPYGARYVGSMVADIHRTLVYGGIFLYPANKKSPSGKLRLLY
ECNPIAYVMEKAGGLATTGDKDILDIVPTEIHQKAPVVMGSSEDVQEFLEIYRKHKAK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_019395
ORF Size 1014 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_019395.1, NM_019395.2, NM_019395.3, NP_062268
RefSeq Size 1433
RefSeq ORF 1017
Locus ID 14121
Cytogenetics 13|13 B3
MW 37.4 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations