Cd200r1 (NM_021325) Mouse Tagged ORF Clone

CAT#: MR204778

Cd200r1 (Myc-DDK-tagged) - Mouse CD200 receptor 1 (Cd200r1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 149.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cd200r1 (NM_021325) Mouse Tagged ORF Clone
Symbol Cd200r1
Synonyms CD200R; Mox2r; OX2R
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR204778 representing NM_021325
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTTGCTTTTGGAGAACTTCTGCCCTAGCAGTGCTCTTAATATGGGGGGTCTTTGTGGCTGGGTCAA
GTTGTACTGATAAGAATCAAACAACACAGAACAACAGTTCATCTCCTCTGACACAAGTGAACACTACAGT
GTCTGTACAGATAGGTACAAAGGCTCTGCTCTGCTGCTTTTCTATTCCACTGACAAAAGCAGTATTAATC
ACATGGATAATAAAGCTCAGAGGCCTGCCATCCTGCACAATAGCATACAAAGTAGATACAAAGACCAATG
AAACCAGCTGCTTGGGCAGGAACATCACCTGGGCCTCCACACCTGACCACAGTCCTGAACTTCAGATCAG
TGCAGTGACCCTCCAGCATGAGGGGACTTACACATGTGAGACAGTAACACCTGAAGGGAATTTTGAAAAA
AACTATGACCTCCAAGTGCTGGTGCCCCCTGAAGTAACCTACTTTCCAGAGAAAAACAGATCTGCAGTCT
GTGAGGCAATGGCAGGCAAGCCTGCTGCACAGATCTCTTGGTCTCCAGATGGGGACTGTGTCACTACGAG
TGAATCACACAGCAATGGCACTGTGACTGTCAGGAGCACATGCCACTGGGAGCAGAACAATGTGTCTGAT
GTGTCCTGCATTGTCTCTCATTTGACTGGTAACCAATCTCTGTCCATAGAACTGAGTAGAGGTGGTAACC
AATCATTACGACCATATATTCCATACATCATACCATCAATTATCATTTTGATCATCATAGGATGCATTTG
TCTTTTGAAAATCAGTGGCTTCAGAAAATGCAAATTGCCAAAATTAGAAGCTACTTCAGCTATTGAGGAG
GATGAAATGCAGCCTTATGCTAGCTATACAGAGAAGAGCAATCCACTCTATGATACTGTGACTAAGGTGG
AGGCATTTCCAGTATCACAAGGCGAAGTCAATGGCACAGACTGCCTTACTTTGTCGGCCATTGGAATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR204778 representing NM_021325
Red=Cloning site Green=Tags(s)

MFCFWRTSALAVLLIWGVFVAGSSCTDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLI
TWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEK
NYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSD
VSCIVSHLTGNQSLSIELSRGGNQSLRPYIPYIIPSIIILIIIGCICLLKISGFRKCKLPKLEATSAIEE
DEMQPYASYTEKSNPLYDTVTKVEAFPVSQGEVNGTDCLTLSAIGI

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021325
ORF Size 978 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021325.1, NM_021325.2, NM_021325.3, NP_067300
RefSeq Size 1975
RefSeq ORF 981
Locus ID 57781
Cytogenetics 16|16 B4
MW 36 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations