Akr1a1 (NM_021473) Mouse Tagged ORF Clone

CAT#: MR204727

  • TrueORF®

Akr1a1 (Myc-DDK-tagged) - Mouse aldo-keto reductase family 1, member A4 (aldehyde reductase) (Akr1a4)

 Cited in 1 publication.

  View "NM_021473" in other vectors (10)

USD 68.00

USD 219.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Akr1a1 (NM_021473) Mouse Tagged ORF Clone
Symbol Akr1a1
Synonyms 2610201A18Rik; Akr1a4
Vector pCMV6-Entry
Sequence Data
>MR204727 representing NM_021473
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGGCCTCCAGTGTCCTCCTGCACACTGGACAGAAGATGCCTCTGATTGGTCTGGGGACATGGAAGA
GTGAGCCTGGTCAGGTGAAAGCAGCCATTAAACATGCCCTTAGCGCAGGCTACCGCCACATTGATTGTGC
TTCTGTATATGGCAATGAAACTGAGATTGGGGAGGCCCTGAAGGAGAGTGTGGGGTCAGGCAAGGCAGTC
CCTCGAGAGGAGCTGTTTGTGACATCCAAGCTGTGGAATACTAAGCACCACCCTGAGGATGTAGAACCTG
CCCTCCGGAAGACACTGGCTGATCTGCAACTGGAGTATTTGGACCTCTATTTGATGCACTGGCCTTATGC
CTTTGAGCGGGGAGACAATCCCTTTCCCAAGAATGCCGATGGAACTGTCAGATATGACTCAACTCACTAT
AAAGAGACCTGGAAGGCTCTGGAGGTACTGGTGGCAAAGGGGCTGGTGAAAGCCCTGGGCTTGTCCAACT
TCAACAGTCGGCAGATTGATGATGTCCTCAGTGTGGCCTCTGTGCGCCCAGCTGTCTTGCAGGTGGAATG
CCATCCATACCTGGCTCAGAATGAGCTCATTGCCCACTGTCACGCACGGGGCTTGGAGGTGACTGCTTAT
AGCCCCTTGGGTTCCTCTGACCGTGCTTGGCGCCATCCTGATGAGCCAGTCCTGCTTGAAGAACCAGTAG
TCTTGGCACTAGCTGAAAAACATGGCCGATCTCCAGCTCAGATCTTGCTTAGATGGCAGGTTCAGCGGAA
AGTGATCTGCATCCCCAAAAGCATCAATCCTTCCCGCATCCTTCAGAACATTCAGGTATTTGATTTCACC
TTTAGCCCAGAGGAGATGAAACAATTAGATGCTCTGAACAAAAATTGGCGGTATATTGTGCCCATGATTA
CGGTGGATGGGAAGAGGGTTCCCAGAGATGCTGGACACCCTCTGTATCCCTTTAATGACCCATAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204727 representing NM_021473
Red=Cloning site Green=Tags(s)

MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKHALSAGYRHIDCASVYGNETEIGEALKESVGSGKAV
PREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVRYDSTHY
KETWKALEVLVAKGLVKALGLSNFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCHARGLEVTAY
SPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSINPSRILQNIQVFDFT
FSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021473
ORF Size 975 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021473.1, NM_021473.2, NM_021473.3, NP_067448
RefSeq Size 1435
RefSeq ORF 978
Locus ID 58810
Cytogenetics 4|4 D1
MW 36.6 kDa

Citations (1)

Other Versions

Other products for "Akr1a1"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Order online and get additional $20 off!
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies