Akr1a1 (NM_021473) Mouse Tagged ORF Clone

CAT#: MR204727

  • TrueORF®

Akr1a1 (Myc-DDK-tagged) - Mouse aldo-keto reductase family 1, member A4 (aldehyde reductase) (Akr1a4)



  "NM_021473" in other vectors (4)

Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "Akr1a1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Akr1a1
Synonyms 2610201A18Rik; Akr1a4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR204727 representing NM_021473
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGGCCTCCAGTGTCCTCCTGCACACTGGACAGAAGATGCCTCTGATTGGTCTGGGGACATGGAAGA
GTGAGCCTGGTCAGGTGAAAGCAGCCATTAAACATGCCCTTAGCGCAGGCTACCGCCACATTGATTGTGC
TTCTGTATATGGCAATGAAACTGAGATTGGGGAGGCCCTGAAGGAGAGTGTGGGGTCAGGCAAGGCAGTC
CCTCGAGAGGAGCTGTTTGTGACATCCAAGCTGTGGAATACTAAGCACCACCCTGAGGATGTAGAACCTG
CCCTCCGGAAGACACTGGCTGATCTGCAACTGGAGTATTTGGACCTCTATTTGATGCACTGGCCTTATGC
CTTTGAGCGGGGAGACAATCCCTTTCCCAAGAATGCCGATGGAACTGTCAGATATGACTCAACTCACTAT
AAAGAGACCTGGAAGGCTCTGGAGGTACTGGTGGCAAAGGGGCTGGTGAAAGCCCTGGGCTTGTCCAACT
TCAACAGTCGGCAGATTGATGATGTCCTCAGTGTGGCCTCTGTGCGCCCAGCTGTCTTGCAGGTGGAATG
CCATCCATACCTGGCTCAGAATGAGCTCATTGCCCACTGTCACGCACGGGGCTTGGAGGTGACTGCTTAT
AGCCCCTTGGGTTCCTCTGACCGTGCTTGGCGCCATCCTGATGAGCCAGTCCTGCTTGAAGAACCAGTAG
TCTTGGCACTAGCTGAAAAACATGGCCGATCTCCAGCTCAGATCTTGCTTAGATGGCAGGTTCAGCGGAA
AGTGATCTGCATCCCCAAAAGCATCAATCCTTCCCGCATCCTTCAGAACATTCAGGTATTTGATTTCACC
TTTAGCCCAGAGGAGATGAAACAATTAGATGCTCTGAACAAAAATTGGCGGTATATTGTGCCCATGATTA
CGGTGGATGGGAAGAGGGTTCCCAGAGATGCTGGACACCCTCTGTATCCCTTTAATGACCCATAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204727 representing NM_021473
Red=Cloning site Green=Tags(s)

MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKHALSAGYRHIDCASVYGNETEIGEALKESVGSGKAV
PREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVRYDSTHY
KETWKALEVLVAKGLVKALGLSNFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCHARGLEVTAY
SPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSINPSRILQNIQVFDFT
FSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021473
ORF Size 975 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021473.3, NP_067448.1
RefSeq Size 1435 bp
RefSeq ORF 978 bp
Locus ID 58810
UniProt ID Q9JII6
Cytogenetics 4 D1
MW 36.6 kDa
Gene Summary Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols. Displays enzymatic activity towards endogenous metabolites such as aromatic and aliphatic aldehydes, ketones, monosaccharides and bile acids, with a preference for negatively charged substrates, such as glucuronate and succinic semialdehyde (By similarity) (PubMed:22820017, PubMed:15769935, PubMed:20410296). Plays an important role in ascorbic acid biosynthesis by catalyzing the reduction of D-glucuronic acid and D-glucurono-gamma-lactone (PubMed:20410296, PubMed:15769935, PubMed:22820017). Functions as a detoxifiying enzyme by reducing a range of toxic aldehydes. Reduces methylglyoxal and 3-deoxyglucosone, which are present at elevated levels under hyperglycemic conditions and are cytotoxic (By similarity). Involved in the detoxification of lipid-derived aldehydes like acrolein (By similarity). Plays a role in the activation of procarcinogens, such as polycyclic aromatic hydrocarbon trans-dihydrodiols, and in the metabolism of various xenobiotics and drugs (By similarity). Displays no reductase activity towards retinoids (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.