Icosl (NM_015790) Mouse Tagged ORF Clone

CAT#: MR204667

Icosl (Myc-DDK-tagged) - Mouse icos ligand (Icosl)

Change vector?

  • TrueORF®

USD 219.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Icosl (NM_015790) Mouse Tagged ORF Clone
Symbol Icosl
Synonyms AU044799; B7-H2; B7h; B7RP-1; BG071784; GI50; GL50; GL50-B; ICOS-L; Icoslg; LICOS; Ly115l;
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR204667 representing NM_015790
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCTAAAGTGTCCCTGTTTTGTGTCCTTGGGAACCAGGCAGCCTGTTTGGAAGAAGCTCCATGTTT
CTAGCGGGTTCTTTTCTGGTCTTGGTCTGTTCTTGCTGCTGTTGAGCAGCCTCTGTGCTGCCTCTGCAGA
GACTGAAGTCGGTGCAATGGTGGGCAGCAATGTGGTGCTCAGCTGCATTGACCCCCACAGACGCCATTTC
AACTTGAGTGGTCTGTATGTCTATTGGCAAATCGAAAACCCAGAAGTTTCGGTGACTTACTACCTGCCTT
ACAAGTCTCCAGGGATCAATGTGGACAGTTCCTACAAGAACAGGGGCCATCTGTCCCTGGACTCCATGAA
GCAGGGTAACTTCTCTCTGTACCTGAAGAATGTCACCCCTCAGGATACCCAGGAGTTCACATGCCGGGTA
TTTATGAATACAGCCACAGAGTTAGTCAAGATCTTGGAAGAGGTGGTCAGGCTGCGTGTGGCAGCAAACT
TCAGTACACCTGTCATCAGCACCTCTGATAGCTCCAACCCGGGCCAGGAACGTACCTACACCTGCATGTC
CAAGAATGGCTACCCAGAGCCCAACCTGTATTGGATCAACACAACGGACAATAGCCTAATAGACACGGCT
CTGCAGAATAACACTGTCTACTTGAACAAGTTGGGCCTGTATGATGTAATCAGCACATTAAGGCTCCCTT
GGACATCTCGTGGGGATGTTCTGTGCTGCGTAGAGAATGTGGCTCTCCACCAGAACATCACTAGCATTAG
CCAGGCAGAAAGTTTCACTGGAAATAACACAAAGAACCCACAGGAAACCCACAATAATGAGTTAAAAGTC
CTTGTCCCCGTCCTTGCTGTACTGGCGGCAGCGGCATTCGTTTCCTTCATCATATACAGACGCACGCGTC
CCCACCGAAGCTATACAGGACCCAAGACTGTACAGCTTGAACTTACAGACCACGCC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR204667 representing NM_015790
Red=Cloning site Green=Tags(s)

MQLKCPCFVSLGTRQPVWKKLHVSSGFFSGLGLFLLLLSSLCAASAETEVGAMVGSNVVLSCIDPHRRHF
NLSGLYVYWQIENPEVSVTYYLPYKSPGINVDSSYKNRGHLSLDSMKQGNFSLYLKNVTPQDTQEFTCRV
FMNTATELVKILEEVVRLRVAANFSTPVISTSDSSNPGQERTYTCMSKNGYPEPNLYWINTTDNSLIDTA
LQNNTVYLNKLGLYDVISTLRLPWTSRGDVLCCVENVALHQNITSISQAESFTGNNTKNPQETHNNELKV
LVPVLAVLAAAAFVSFIIYRRTRPHRSYTGPKTVQLELTDHA

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_015790
ORF Size 966 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015790.1, NM_015790.2, NM_015790.3, NP_056605
RefSeq Size 2748
RefSeq ORF 969
Locus ID 50723
Cytogenetics 10|10 C1
MW 36.4 kDa
Gene Summary Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells. Could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function. During pregnancy, may function to skew the cytokine of maternal T-cells toward immunoprotective Th2 phenotype. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.