Crhbp (NM_198408) Mouse Tagged ORF Clone

CAT#: MR204660

Crhbp (Myc-DDK-tagged) - Mouse corticotropin releasing hormone binding protein (Crhbp)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 219.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Crhbp (NM_198408) Mouse Tagged ORF Clone
Symbol Crhbp
Synonyms CRH-BP
Vector pCMV6-Entry
Sequence Data
>MR204660 representing NM_198408
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCACCGAACTTCAAACTCCAATGTCACTTCATTCTGATCCTCCTGACAGCTCTAAGGGGAGAGAGCC
GCTACCTAGAGGTGCAAGAAGCCGCGGTCTACGACCCTCTCCTGCTCTTCAGTGCCAATCTGAAGCGGGA
CCTGGCAGAGGAGCAGCCGTACCGACGGGCTCTGCGGTGCCTGGACATGCTGAGCCTCCCTGGCCAGTTC
ACCTTCACCGCAGACCGGCCGCAGCTGCACTGCGCCGCCTTCTTCATCGGCGAACCCGAGGAATTCATCA
CCATCCACTATGACCTGGTCTCCATCGACTGCCAAGGCGGGGATTTCCTGAAGGTATTTGATGGTTGGAT
CCTAAAGGGAGAGAAATTCCCAAGTTCTCAGGATCACCCTCTGCCCACTATGAAGAGGTACACAGATTTC
TGTGAGAGTGGTCTTACCAGAAGGAGCATCAGGTCTTCCCAGAATGTGGCCATGGTCTTCTTCCGGGTCC
ACGAACCAGGAAATGGATTCACGATAACCATAAAGACAGATCCCAACCTCTTCCCTTGCAATGTCATCTC
TCAGACTCCGAGTGGAAGGTTTACTTTAGTGGTTCCATACCAGCACCAAAACTGCAGCTTCTCCATCATC
TATCCAGTGGCAATCAAAATCTCTGATCTTACCCTCGGACACTTGCATGGCCTTCAGTTAAAGAAACCTG
CGGCTGGCTGCGGTGGGACTGGTGACTTTGTGGAGCTGCTGGGAGGAACTGGATTGGACCCCTCCAAGAT
GATGCCCTTAGCAGACCTGTGTTACCCCTTTCTCGGCCCTGCCCAGATGAAAATTAGCTGCGACAATGCT
GTGGTACGCATGGTCTCCAGTGGGAAACACATTAACCGTGTGACATTTGAGTATCGTCAGCTGGAGCCAT
TCGAGCTAGAAACCTCGACCGGAAACAGCATCCCAGAATACTGTTTGTCTAGTCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204660 representing NM_198408
Red=Cloning site Green=Tags(s)

MSPNFKLQCHFILILLTALRGESRYLEVQEAAVYDPLLLFSANLKRDLAEEQPYRRALRCLDMLSLPGQF
TFTADRPQLHCAAFFIGEPEEFITIHYDLVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPTMKRYTDF
CESGLTRRSIRSSQNVAMVFFRVHEPGNGFTITIKTDPNLFPCNVISQTPSGRFTLVVPYQHQNCSFSII
YPVAIKISDLTLGHLHGLQLKKPAAGCGGTGDFVELLGGTGLDPSKMMPLADLCYPFLGPAQMKISCDNA
VVRMVSSGKHINRVTFEYRQLEPFELETSTGNSIPEYCLSSL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_198408
ORF Size 966 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_198408.1, NM_198408.2, NM_198408.3, NP_940800
RefSeq Size 1650
RefSeq ORF 969
Locus ID 12919
Cytogenetics 13 D1|13 49.5 cM
MW 36.5 kDa
Gene Summary Binds CRF and inactivates it. May prevent inappropriate pituitary-adrenal stimulation in pregnancy. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)