Crk (NM_133656) Mouse Tagged ORF Clone

CAT#: MR204260

Crk (Myc-DDK-tagged) - Mouse v-crk sarcoma virus CT10 oncogene homolog (avian) (Crk)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 149.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Crk (NM_133656) Mouse Tagged ORF Clone
Symbol Crk
Synonyms c-Crk; Crk-I; Crk-II; Crk-III; Crk3; CrkIII; Crko; p38
Vector pCMV6-Entry
Sequence Data
>MR204260 representing NM_133656
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGCAACTTCGACTCGGAGGAGCGGAGTAGCTGGTACTGGGGCCGCCTGAGCCGGCAGGAGGCGG
TGGCGCTATTGCAGGGCCAGCGGCACGGGGTGTTCCTGGTGCGGGACTCGAGCACCAGCCCCGGGGACTA
TGTGCTTAGCGTCTCCGAAAACTCGCGCGTCTCCCACTACATCATCAACAGCAGCGGCCCGCGCCCTCCA
GTGCCTCCGTCGCCCGCTCAGCCTCCGCCGGGAGTGAGTCCCTCCAGGCTCCGAATAGGAGATCAAGAAT
TTGATTCATTGCCTGCTTTACTGGAATTCTACAAAATACACTATTTGGACACTACAACATTGATAGAACC
AGTGGCCAGATCAAGGCAGGGTAGTGGAGTGATTCTCAGGCAGGGGGAGGCAGAGTATGTGCGGGCCCTC
TTTGACTTTAATGGGAATGATGAAGAAGATCTTCCCTTTAAGAAAGGAGACATGCTGAGAATCCGGGATA
AGCCTGAAGAGCAGTGGTGGAATGCAGAGGACAGCGAAGGAAAGAGGGGGATGATTCCTGTCCCTTACGT
GGAGAAGTATAGACAGGCCTCCGCCTCAGTATCGGCTCTGATTGGAGGTAACCAGGAGGGTTCCCACCCA
CAGCCACTGGGTGGGCCGGAGCCTGGGCCCTATGCCCAACCCAGCGTCAACACTCCGCTCCCTAACCTCC
AGAATGGGCCCATTTATGCCAGGGTTATCCAGAAGCGAGTCCCTAATGCCTACGACAAGACAGCCTTGGC
TTTGGAGGTCGGTGAGCTGGTAAAGGTTACGAAGATTAATGTGAGTGGTCAGTGGGAAGGGGAGTGTAAT
GGCAAACGAGGTCACTTCCCATTCACACATGTCCGTCTGCTGGATCAACAGAATCCCGATGAGGACTTCA
GC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204260 representing NM_133656
Red=Cloning site Green=Tags(s)

MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPP
VPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVARSRQGSGVILRQGEAEYVRAL
FDFNGNDEEDLPFKKGDMLRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRQASASVSALIGGNQEGSHP
QPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECN
GKRGHFPFTHVRLLDQQNPDEDFS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_133656
ORF Size 912 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_133656.1, NM_133656.2, NM_133656.3, NM_133656.4, NM_133656.5, NP_598417
RefSeq Size 3621
RefSeq ORF 915
Locus ID 12928
Cytogenetics 11 B5|11 45.92 cM
MW 34.3 kDa
Gene Summary This gene is part of a family of adapter proteins that mediate formation of signal transduction complexes in response to extracellular stimuli, such as growth and differentiation factors. Protein-protein interactions occur through the SH2 domain, which binds phosphorylated tyrosine residues, and the SH3 domain, which binds proline-rich peptide motifs. These interactions promote recruitment and activation of effector proteins to regulate cell migration, adhesion, and proliferation. In mouse this protein is essential for embryonic development. Alternatively spliced transcripts encoding different isoforms with distinct biological activity have been described. [provided by RefSeq, Mar 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)