Zdhhc3 (NM_026917) Mouse Tagged ORF Clone

SKU
MR204174
Zdhhc3 (Myc-DDK-tagged) - Mouse zinc finger, DHHC domain containing 3 (Zdhhc3)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Zdhhc3
Synonyms 1110020O22Rik; 1810006O10Rik; 2210017C02Rik; DHHC-3; GODZ; Gramp1; Zfp373
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR204174 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)



ATGATGCTTATCCCCACCCATCACTTCCGAGACATTGAGCGGAAACCAGAGTACCTCCAGCCAGAGAAGT
GTGCCCCACCTCCCTTCCCTGGTCCTGCGGGAGCCATGTGGTTTATCCGAGATGGCTGTGGCATTGCTTG
TGCCATTGTCACCTGGTTTCTGGTCCTCTATGCGGAGTTTGTAGTCCTCTTTGTCATGCTGGTTCCATCC
CGAGACTACGCGTACAGCATCATCAACGGAATTGTGTTCAACCTGCTGGCCTTCTTGGCCCTGGCCTCCC
ACTGCCGGGCCATGCTGACGGACCCCGGGGCAGTGCCCAAAGGAAATGCCACTAAAGAGTTCATCGAGAG
CCTTCAGCTGAAGCCTGGGCAGGTGGTGTACAAGTGTCCCAAGTGCTGCAGCATCAAGCCCGACCGGGCA
CACCACTGCAGTGTTTGTAAGCGGTGCATTCGCAAGATGGATCACCACTGTCCTTGGGTCAACAACTGTG
TCGGCGAGAACAACCAGAAGTACTTTGTCCTATTCACAATGTACATAGCTCTCATTTCCTTGCACGCCCT
CATCATGGTGGGATTCCACTTCCTGCATTGCTTTGAAGAAGACTGGACAAAGTGCAGCTCCTTCTCGCCG
CCCACCACAGTCATCCTGCTCATCCTGCTGTGCTTTGAGGCCCTGCTCTTCCTCATTTTCACATCAGTGA
TGTTTGGGACCCAAGTACACTCCATCTGCACAGATGAGACGGGCATAGAACAATTGAAAAAGGAAGAGAG
AAGATGGGCTAAAAAAACAAAATGGATGAACATGAAAGCCGTGTTTGGCCACCCTTTCTCTCTAGGCTGG
GCCAGCCCCTTTGCCACACCAGACCAAGGGAAGGCAGACCCGTACCAGTATGTGGTC


Protein Sequence
>MR204174 protein sequence
Red=Cloning site Green=Tags(s)

MMLIPTHHFRDIERKPEYLQPEKCAPPPFPGPAGAMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLVPS
RDYAYSIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRA
HHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTKCSSFSP
PTTVILLILLCFEALLFLIFTSVMFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGW
ASPFATPDQGKADPYQYVV

Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_026917
ORF Size 840 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026917.6
RefSeq Size 6987 bp
RefSeq ORF 900 bp
Locus ID 69035
UniProt ID Q8R173
Cytogenetics 9 F4
MW 34 kDa
Summary Palmitoyltransferase with broad specificity. Palmitoylates GABA receptors on their gamma subunit (GABRG1, GABRG2 and GABRG3), which regulates synaptic clustering and/or cell surface stability (PubMed:15229235). Palmitoylates glutamate receptors GRIA1 and GRIA2, which leads to their retention in Golgi (PubMed:16129400). May also palmitoylate DLG4, DNAJC5 and SNAP25 (PubMed:15603741, PubMed:25253725).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Zdhhc3 (NM_026917) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC205200 Zdhhc3 (untagged) - Mouse zinc finger, DHHC domain containing 3 (Zdhhc3), (10ug) 10 ug
$300.00
MG204174 Zdhhc3 (tGFP-tagged) - Mouse zinc finger, DHHC domain containing 3 (Zdhhc3) 10 ug
$500.00
MR204174L3 Lenti ORF clone of Zdhhc3 (Myc-DDK-tagged) - Mouse zinc finger, DHHC domain containing 3 (Zdhhc3) 10 ug
$600.00
MR204174L4 Lenti ORF clone of Zdhhc3 (mGFP-tagged) - Mouse zinc finger, DHHC domain containing 3 (Zdhhc3) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.