Nhej1 (NM_029342) Mouse Tagged ORF Clone

CAT#: MR204061

  • TrueORF®

Nhej1 (Myc-DDK-tagged) - Mouse nonhomologous end-joining factor 1 (Nhej1)

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro



  "NM_029342" in other vectors (4)

Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "Nhej1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Nhej1
Synonyms 1700029B21Rik; cernunnos; XLF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR204061 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGAGCTAGAGCAAGACCTGTTGCTGCAGCCATGGGCATGGTTACAACTTGCGGAGAACTCACTCT
TAGCCAAGGTGTCTATCACCAAGCACGGTTATGCCTTGCTGATTTCGGATCTTCAACAGGTGTGGCATGA
ACAGGTGGACACTTCGGTGGTCAGCCAGCGAGCCAAGGAGCTGAACAAGCGCCTCACTGCGCCTCCTGCA
GCTTTGCTCTGTCACCTGGATGAAGCACTTCGCCCACTGTTTAAAGATTCTGCTCACCCTAGCAAAGCTA
CTTTCTCCTGTGACCGAGGAGAGGAGGGACTGATCCTGCGGGTGCAGAGTGAGCTCTCGGGTCTTCCCTT
CAGTTGGCATTTCCACTGTATTCCAGCTAGTTCTTCACTGGTCTCTCAGCATTTGATTCATCCTCTGATG
GGTGTGAGCCTGGCACTGCAGAGTCATGTGAGGGAGCTAGCAGCATTGCTTCGGATGAAGGACCTTGAGA
TCCAGGCCTACCAGGAGAGTGGGGCTGTGCTGAGCCGAAGTCGATTGAAGACAGAGCCATTTGAAGAAAA
TTCTTTCTTGGAACAGTTTATGGCAGAGAAATTGCCAGAGGCGTGTGCTGTTGGTGATGGAAAGCCATTT
GCCATGAGTCTGCAGAGTCTGTATGTGGCAGTTACAAAACAGCAGATCCAAGCAAGGCAGGCACATAAAG
ACTCTGGAGAGACTCAGGCATCAAGCAGCACCTCCCCTCGAGGAACTGATAACCAGCCAGAAGAGCCGGT
CTCCCTCCCTTCCACCCTCTCAGAACCTGAATATGAGCCTGTGGCTGCTTCAGGCCCTATGCATAGAGCT
CAGCTGGTGAAGTCCAAGAGGAAGAAGCCCAGGGGACTCTTCAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204061 protein sequence
Red=Cloning site Green=Tags(s)

MEELEQDLLLQPWAWLQLAENSLLAKVSITKHGYALLISDLQQVWHEQVDTSVVSQRAKELNKRLTAPPA
ALLCHLDEALRPLFKDSAHPSKATFSCDRGEEGLILRVQSELSGLPFSWHFHCIPASSSLVSQHLIHPLM
GVSLALQSHVRELAALLRMKDLEIQAYQESGAVLSRSRLKTEPFEENSFLEQFMAEKLPEACAVGDGKPF
AMSLQSLYVAVTKQQIQARQAHKDSGETQASSSTSPRGTDNQPEEPVSLPSTLSEPEYEPVAASGPMHRA
QLVKSKRKKPRGLFS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_029342
ORF Size 888 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_029342.2
RefSeq Size 1415 bp
RefSeq ORF 888 bp
Locus ID 75570
UniProt ID Q3KNJ2
Cytogenetics 1 C4
MW 32.7 kDa
Gene Summary DNA repair protein involved in DNA nonhomologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. May serve as a bridge between XRCC4 and the other NHEJ factors located at DNA ends, or may participate in reconfiguration of the end bound NHEJ factors to allow XRCC4 access to the DNA termini. It may act in concert with XRCC6/XRCC5 (Ku) to stimulate XRCC4-mediated joining of blunt ends and several types of mismatched ends that are noncomplementary or partially complementary (PubMed:17360556). Binds DNA in a length-dependent manner (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.