Batf2 (NM_028967) Mouse Tagged ORF Clone

CAT#: MR203728

Batf2 (Myc-DDK-tagged) - Mouse basic leucine zipper transcription factor, ATF-like 2 (Batf2)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 219.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Batf2 (NM_028967) Mouse Tagged ORF Clone
Symbol Batf2
Synonyms 4933430F08Rik
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR203728 representing NM_028967
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAACTCTGTGGGAGTAGCGAGCTGCTGACTGAGACAGACCTTGGGGAGTCTCAGAAACAGCTGAAGA
AGAAGCAGAAGAACCGAGTGGCTGCCCAGCGCAGCCGGCAGAAGCACACCAGTAAGGCGGACGCTCTGCA
CCAGCAGCACGAATCCTTGGAGAAACAGAACCACGCCCTTCGGAAGGAGATCCAGGCCTTGCAGACTGAG
CTGGCAGGGTGGGGCCGGACACTGCACTTGCATGAACGCCTGTGCAGAGTGGACTGTGATCCCTGCCCTG
TTCTGCTGCCCTCTGGATGCCCAATCCAGGCCAAGCAACCCTCAGGACAACCTGCCCCTCTTGGATACAA
TGGCTGCCAGGAACAACTGGGCCTGTTCCAGACTCCGGGCTCATCTCCCCGAGCCCAGCATCTCTCTCCA
GGTCCATGCTCTCATGAGTCTCCTGGCCTCCTCCCTTCCCTCCTGCCTTCACTGGCCTTTGACCCTCTCA
TGGTGAGGACACCTCTAGCCCAGCTCTCCCCCAGCCCTGTCCTGTCTGCATCATCACCTTCTGGTTCCAG
CCTGCTGGGGTCTTTCTCTAAGCTTGATCCCCTCATACCCAGCCCCCAAGACCAACTGGCCCCACCACAA
CCCCTCAGGCAGGAGCAGCCCACCAGTGGGAGGCTGGCATCCTCTGACTCTCCAGCTGCTCTGGGACCAG
AGTGTTCACAGAACAGAGAGCATTTGCCGGCACTGCCTGGCTCCTCCACTCATTGGCAGAAGTCATCTGT
GGCCCCTAGCCCACAGGCCCTCATGGCCTTCCCCCTGCTTTCTTCTGCAAAAGTCCACTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR203728 representing NM_028967
Red=Cloning site Green=Tags(s)

MQLCGSSELLTETDLGESQKQLKKKQKNRVAAQRSRQKHTSKADALHQQHESLEKQNHALRKEIQALQTE
LAGWGRTLHLHERLCRVDCDPCPVLLPSGCPIQAKQPSGQPAPLGYNGCQEQLGLFQTPGSSPRAQHLSP
GPCSHESPGLLPSLLPSLAFDPLMVRTPLAQLSPSPVLSASSPSGSSLLGSFSKLDPLIPSPQDQLAPPQ
PLRQEQPTSGRLASSDSPAALGPECSQNREHLPALPGSSTHWQKSSVAPSPQALMAFPLLSSAKVHF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_028967
ORF Size 831 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_028967.1, NP_083243
RefSeq Size 1433
RefSeq ORF 834
Locus ID 74481
Cytogenetics 19|19 A
MW 30.2 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)