Cited2 (NM_010828) Mouse Tagged ORF Clone

CAT#: MR203568

Cited2 (Myc-DDK-tagged) - Mouse Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2 (Cited2)

Product Images

Circular map for MR203568

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Cited2
• Synonyms: AI835299; ER154-like; Mrg1; Msg2; p35srj
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR203568 representing NM_010828
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCAGACCATATGATGGCCATGAACCACGGGCGCTTCCCCGACGGCACCAACGGGCTGCACCACCACC
  CTGCCCACCGCATGGGCATGGGGCAGTTCCCGAGCCCGCATCATCACCAGCAGCAGCAGCCCCAGCACGC
  CTTCAACGCCCTCATGGGCGAGCACATACACTACGGCGCGGGCAACATGAATGCCACGAGCGGCATCAGG
  CACGCCATGGGGCCGGGGACTGTGAACGGGGGGCACCCCCCGAGCGCTCTGGCCCCGGCCGCCAGGTTTA
  ACAACTCCCAGTTCATGGGTCCCCCGGTGGCCAGCCAGGGAGGCTCCCTGCCGGCCAGCATGCAGCTGCA
  GAAGCTCAACAACCAGTATTTCAACCATCACCCCTACCCCCACAACCACTACATGCCGGATTTGCACCCC
  ACTGCAGGCCACCAGATGAACGGGACAAACCAGCACTTCCGAGATTGCAACCCCAAGCACAGCGGAGGCA
  GCAGCACCCCTGGCGGTGCGGGTGGCAGCGGCACCCCCGGCGGCTCCGGCGGCACCTCGGGCGGCGCGGG
  TGGCAGCAGCGCGGGCGGCAGCGGCGGTGGCAGCACCATGCCCGCCTCGGTGGCTCACGTCCCCGCGGCA
  ATGCTGCCGCCCAATGTCATAGACACTGATTTCATCGACGAGGAAGTGCTTATGTCCTTAGTGATAGAAA
  TGGGTTTGGACCGCATCAAGGAGCTGCCCGAACTCTGGCTGGGCCAAAATGAGTTTGATTTTATGACGGA
  CTTCGTGTGCAAGCAGCAGCCCAGCAGAGTCAGCTGT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR203568 representing NM_010828
  Red=Cloning site Green=Tags(s)
  
  MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIR
  HAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHP
  TAGHQMNGTNQHFRDCNPKHSGGSSTPGGAGGSGTPGGSGGTSGGAGGSSAGGSGGGSTMPASVAHVPAA
  MLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_010828
• ORF Size: 807 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_010828.3, NP_034958.2
• RefSeq Size: 1980 bp
• RefSeq ORF: 810 bp
• Locus ID: 17684
• UniProt ID: O35740
• Cytogenetics: 10 A2
• MW: 28.3 kDa
• Gene Summary: Transcriptional coactivator of the p300/CBP-mediated transcription complex. Acts as a bridge, linking TFAP2 transcription factors and the p300/CBP transcriptional coactivator complex in order to stimulate TFAP2-mediated transcriptional activation. Positively regulates TGF-beta signaling through its association with the SMAD/p300/CBP-mediated transcriptional coactivator complex. Stimulates the peroxisome proliferator-activated receptors PPARA transcriptional activity. Enhances estrogen-dependent transactivation mediated by estrogen receptors. Acts also as a transcriptional corepressor; interferes with the binding of the transcription factors HIF1A or STAT2 and the p300/CBP transcriptional coactivator complex. Participates in sex determination and early gonad development by stimulating transcription activation of SRY. Plays a role in controlling left-right patterning during embryogenesis; potentiates transcriptional activation of NODAL-mediated gene transcription in the left lateral plate mesoderm (LPM). Plays an essential role in differentiation of the adrenal cortex from the adrenogonadal primordium (AGP); stimulates WT1-mediated transcription activation thereby up-regulating the nuclear hormone receptor NR5A1 promoter activity. Associates with chromatin to the PITX2 P1 promoter region.[UniProtKB/Swiss-Prot Function]